TkA04G012260 | RubberDandelionOmics

Gene overview

TkA04G012260

Reference: TK1151 Chr: Chr04 Coordinates: 3054282-3060965 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2610 bp · TkA04G012260|TK1151|cDNA

CAACAATGTAAATACTACAATGATATTAAACCACCAATGTTGTCGAAGCAAAACCTCATGCTGTGTTTGGTTGGCAGGAAAAGAAGAGAATTAGAAAGAAAATGATTCAAATTTCTTCGAATTCTTGCAGTTGGTTGGCATTAGCATGGAAAAAGGAATCCTAAATGAAACTTTTTTTCCTTCCGCTGATGGATTCTATTTTCCATCGTAAGCTGCAAGGAATTCATTCCTTTGGATGAGGGAAAATAACAAAAAGTCCA...

CDS

Download CDS FASTA

1719 bp · TkA04G012260|TK1151|CDS

ATGCAGAGCATCAACCCATGGTTTAGCAACGTTAATTCACTCTCCGGCAATTTCATTTCTCCTCAACGTCGATTACGTGTAGCAGGTAGACATGCACATAGCCTCAATTTACAGCCTGTACCATGTGACAGAAGATTATTTCCCCTCAAGTCCAAGAATTCAAAACTTTTCAAAATTCCCTTTTATTCAATCAAATCCCACAATTCACAAATATCCATACACAATCAGCCCAAAAGAATCCATACAAGAATCCATTCAGC...

Protein

Download Protein FASTA

572 aa · TkA04G012260|TK1151|PROTEIN

MQSINPWFSNVNSLSGNFISPQRRLRVAGRHAHSLNLQPVPCDRRLFPLKSKNSKLFKIPFYSIKSHNSQISIHNQPKRIHTRIHSASSESLSHGSLINQTSETEFEFTPEDSKSQPKPKYENRFLIFARVGSVINNAAESFFKSEIRRRLFVTAALLVISRVGYFIPLPGFDRRLVPENYLSFVSGSVEELGELAPELKLSLFQLGISPQIAASIVMQVLCYVLPSLVKLRKEGLDANEKIKGYIWWMSFGFAILEALV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G012260`
TK1151 ID	TkA04G012260
OH-1004 ID	LXL04_036982
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 98.252 / OH-1004 97.739 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G012260

Location Chr04:3054282-3060965 (-)

Description Similar to SCY2: Preprotein translocase subunit SCY2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31530`	Involved in protein export.	Plastids contain a second sec translocase system with essential functions.2011 · DOI: 10.1104/pp.110.166546

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036982 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006605 protein targeting Biological Process

GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0065002 intracellular protein transmembrane transport Biological Process

GO:0072598 protein localization to chloroplast Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009526 plastid envelope Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0033097 amyloplast membrane Cellular Component

GO:0005048 signal sequence binding Molecular Function

KEGG gene cross-reference

ath:AT2G31530

syc:syc1883_d

syf:Synpcc7942_2214

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · TkA04G012260 · TK1151

Mitochondrion0.030

Rank 2 · TkA04G012260 · TK1151

Nucleus0.017

Rank 3 · TkA04G012260 · TK1151

Cell membrane0.016

Rank 4 · TkA04G012260 · TK1151

Cytoplasm0.015

Rank 5 · TkA04G012260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00344SecY202-549 aa

PF08515TGF_beta_GS304-311 aa

PF08515TGF_beta_GS327-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G012260	`PF00344`	SecY	202	549	3.1e-70	237.7
TkA04G012260	`PF08515`	TGF_beta_GS	304	311	1.3	9.4
TkA04G012260	`PF08515`	TGF_beta_GS	327	344	1.3	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IQV7`	Arabidopsis thaliana	sp\|F4IQV7\|SCY2_ARATH Preprotein translocase subunit SCY2, chloroplastic	78.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card