TkA04G011350 | RubberDandelionOmics

Gene overview

TkA04G011350

Reference: TK1151 Chr: Chr04 Coordinates: 2759377-2764583 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2628 bp · TkA04G011350|TK1151|cDNA

GCCGCCCTTCCCTCCTACAATTTCACCTTCCCCCAAACCCTCGCAATTTCTCCCAAATTCAAACCCTTAATTTCATATTTCTCACATCACTCATTACAACGGGAATTAACCTGTTTGTTGCATTCTTCTTCTCGTTGGAATCCATCAATTTGCTGAGGAAAAACAGCTGAAACTGTAGGTGGCATTTGGTCTTCGAGAATAAACATGGCTAGTCTTTCCGACATTGCTGTATCTGCTGCTATCAACAGTTTTTCAGCGGT...

CDS

Download CDS FASTA

2118 bp · TkA04G011350|TK1151|CDS

ATGTACCTAAAATTCTTAAATTGGATGCCTGCTGCTTTACGAATGCCAGAACCTGAGCTTATTGAACATGCTGGACTTGATTCTGCTGTGTATGTTCGAATATACCTTCTTGGGTTGAAGATATTTTGCCCTATCACTCTACTTGCATTTGGTGTGCTGGTACCTATTAATTATACAGGGGAAAATTTTGAGGAATTAACAGTGAATATGAAAGATCTAACTTACAATGATATTGACAAGCTCTCAATATCCAATATTGC...

Protein

Download Protein FASTA

705 aa · TkA04G011350|TK1151|PROTEIN

MYLKFLNWMPAALRMPEPELIEHAGLDSAVYVRIYLLGLKIFCPITLLAFGVLVPINYTGENFEELTVNMKDLTYNDIDKLSISNIAPGSKRLYAHIIMAYVFTFWTCYALFNEYRIVSKMRLHFLANERRRPDQFTVLVRNVPPDDDESVSEHVEHFFCVNHPDHYLSHQIVYNANALADMVIMKKTLQNWLTYYTNKFERNPNKRPTTKSGFWGLWGKNVDAIDFYTQQIEALSKEEEAERERVLNDPDAIVPAAFVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G011350`
TK1151 ID	TkA04G011350
OH-1004 ID	LXL04_018838
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.500
Protein coverage (%)	TK1151 96.028 / OH-1004 43.839 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G011350

Location Chr04:2759377-2764583 (-)

Description Similar to At4g02900: CSC1-like protein At4g02900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02900`	Calcium-permeable channel involved in plant stomatal immunity.	No verified direct reference in this release
`At3g21620`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g11960`	Calcium-permeable channel that plays a key role in plant stomatal immunity.	The calcium-permeable channel OSCA1.3 regulates plant stomatal immunity.2020 · DOI: 10.1038/s41586-020-2702-1
`At4g04340`	May act as a hyperosmolarity-gated nonselective cation channel permeable to Ca²⁺.	OSCA1 mediates osmotic-stress-evoked Ca2+ increases vital for osmosensing in Arabidopsis.2014 · DOI: 10.1038/nature13593 OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844
`At4g22120`	Acts as an osmosensitive calcium-permeable cation channel.	OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844 Structure-guided mutagenesis of OSCAs reveals differential activation to mechanical stimuli.2024 · DOI: 10.7554/elife.93147

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018838 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010118 stomatal movement Biological Process

GO:0045087 innate immune response Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005227 calcium-activated cation channel activity Molecular Function

GO:0005262 calcium channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G11960

ath:AT3G21620

ath:AT4G02900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.839

Rank 1 · TkA04G011350 · TK1151

Cytoplasm0.136

Rank 2 · TkA04G011350 · TK1151

Endoplasmic reticulum0.062

Rank 3 · TkA04G011350 · TK1151

Lysosome / Vacuole0.037

Rank 4 · TkA04G011350 · TK1151

Golgi apparatus0.037

Rank 5 · TkA04G011350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13967RSN1_TM4-114 aa

PF14703PHM7_cyt135-297 aa

PF13967RSN1_TM307-328 aa

PF02714RSN1_7TM308-580 aa

PF13967RSN1_TM370-382 aa

PF13967RSN1_TM527-552 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G011350	`PF13967`	RSN1_TM	4	114	5.9e-32	111.2
TkA04G011350	`PF14703`	PHM7_cyt	135	297	2e-46	159.1
TkA04G011350	`PF13967`	RSN1_TM	307	328	5.9e-32	111.2
TkA04G011350	`PF02714`	RSN1_7TM	308	580	2.1e-85	287.2
TkA04G011350	`PF13967`	RSN1_TM	370	382	5.9e-32	111.2
TkA04G011350	`PF13967`	RSN1_TM	527	552	5.9e-32	111.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY14`	Arabidopsis thaliana	sp\|Q9SY14\|OSC17_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.7	71.600%	Swiss-Prot	High
`Q9LVE4`	Arabidopsis thaliana	sp\|Q9LVE4\|OSC15_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.5	63.300%	Swiss-Prot	High
`B5TYT3`	Arabidopsis thaliana	sp\|B5TYT3\|OSC13_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.3	62.500%	Swiss-Prot	High
`Q9XEA1`	Arabidopsis thaliana	sp\|Q9XEA1\|OSC11_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.1	63.700%	Swiss-Prot	High
`Q5XEZ5`	Arabidopsis thaliana	sp\|Q5XEZ5\|OSC12_ARATH Hyperosmolality-gated Ca2+ permeable channel 1.2	65.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card