Gene Card
Gene overview
cDNA / CDS / Protein Sequences
512 bp · TkA04G010980|TK1151|cDNA
ATGTGTCTAACTTACCCTTTTTCTTTACTCTTACCAAAATCCATCAGAGATGAGGATGTGCTGCAGGCTTGTAAGTTTCGTGCCAGGTGTCGGTTCCCTTCTATATCATGGTGTGATGCACGGGCTGGAGTTGTTCTAGCAAGATCATCTCAACCATTAGTTGGTCTCATGATGAATATGAGAAGGGCAATGTTAGTGTACACTGCACAAAGTAGATCCGACAAAATGATTAACTTCATGTGGGAACAAGTTCGGGTACC...
312 bp · TkA04G010980|TK1151|CDS
ATGTGTCTAACTTACCCTTTTTCTTTACTCTTACCAAAATCCATCAGAGATGAGGATGTGCTGCAGGCTTGTAAGTTTCGTGCCAGGTGTCGGTTCCCTTCTATATCATGGTGTGATGCACGGGCTGGAGTTGTTCTAGCAAGATCATCTCAACCATTAGTTGGTCTCATGATGAATATGAGAAGGGCAATGTTAGTGTACACTGCACAAAGTAGATCCGACAAAATGATTAACTTCATGTGGGAACAAGTTCGGGTACC...
Protein
Download Protein FASTA103 aa · TkA04G010980|TK1151|PROTEIN
MCLTYPFSLLLPKSIRDEDVLQACKFRARCRFPSISWCDARAGVVLARSSQPLVGLMMNMRRAMLVYTAQSRSDKMINFMWEQVRVPKQPVEAQSVAIMCASS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G010980 |
|---|---|
| TK1151 ID | TkA04G010980 |
| OH-1004 ID | LXL04_022114 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 91.800 |
| Protein coverage (%) | TK1151 59.223 / OH-1004 7.168Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G010980 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:2635464-2636434 (+) | |||||||||
| Description | Similar to MTM1: Phosphatidylinositol-3-phosphatase myotubularin-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002091 negative regulation of receptor internalization Biological Process GO:0006661 phosphatidylinositol biosynthetic process Biological Process GO:0016311 dephosphorylation Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0042631 cellular response to water deprivation Biological Process GO:0045806 negative regulation of endocytosis Biological Process GO:0046488 phosphatidylinositol metabolic process Biological Process GO:0046856 phosphatidylinositol dephosphorylation Biological Process GO:0060304 regulation of phosphatidylinositol dephosphorylation Biological Process GO:0097062 dendritic spine maintenance Biological Process GO:2000070 regulation of response to water deprivation Biological Process GO:2000643 positive regulation of early endosome to late endosome transport Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G10550 ath:AT5G04540 bta:536810 hsa:8898 mmu:77116 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06602Myotub-related1-67 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G010980 | PF06602 | Myotub-related | 1 | 67 | 1.5e-16 | 60.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.