Gene Card
Gene overview
cDNA / CDS / Protein Sequences
546 bp · TkA04G007040|TK1151|cDNA
ATGCCAACAAATTATGGTGGATTTAGGGAGAAAGTGAAGGGTATAAAGGTAAGGAAGACCATTGAGGCTCTCGATCAACTAAAGGGATTGCCATCTGGCGGTAATGTTGAAGCTGGTGAGATTCCATCTTTGGCTGATTTGGGTCTTAATCCTACCGCTTCCATGAGTCAGGTCAAACCGATTCCAAATGCTCCCATTGTTGGAGGCGAGAGTGTCGCAATGAACAGACTTAAGCAATTTGCAGCTGAATGCCAAGCACA...
546 bp · TkA04G007040|TK1151|CDS
ATGCCAACAAATTATGGTGGATTTAGGGAGAAAGTGAAGGGTATAAAGGTAAGGAAGACCATTGAGGCTCTCGATCAACTAAAGGGATTGCCATCTGGCGGTAATGTTGAAGCTGGTGAGATTCCATCTTTGGCTGATTTGGGTCTTAATCCTACCGCTTCCATGAGTCAGGTCAAACCGATTCCAAATGCTCCCATTGTTGGAGGCGAGAGTGTCGCAATGAACAGACTTAAGCAATTTGCAGCTGAATGCCAAGCACA...
Protein
Download Protein FASTA181 aa · TkA04G007040|TK1151|PROTEIN
MPTNYGGFREKVKGIKVRKTIEALDQLKGLPSGGNVEAGEIPSLADLGLNPTASMSQVKPIPNAPIVGGESVAMNRLKQFAAECQAQPPKETKDGSNDSIYGANFSCKISPWLAMGCLSPRSMFDELKNSASRTVSSGSNGKDGDGGMNWLMYELLWRDFFRFITRKYSSSKQHNIAPVTV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G007040 |
|---|---|
| TK1151 ID | TkA04G007040 |
| OH-1004 ID | LXL04_001158 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 72.800 |
| Protein coverage (%) | TK1151 99.448 / OH-1004 41.425Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G007040 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:1665316-1666251 (+) | ||||||||||||
| Description | Similar to PHR2: Blue-light photoreceptor PHR2 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000719 photoreactive repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0003677 DNA binding Molecular Function GO:0003684 damaged DNA binding Molecular Function GO:0003904 deoxyribodipyrimidine photo-lyase activity Molecular Function GO:0003913 DNA photolyase activity Molecular Function GO:0009881 photoreceptor activity Molecular Function GO:0050660 flavin adenine dinucleotide binding Molecular Function GO:0071949 FAD binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT2G47590 dre:402986 gvi:glr0835 syn:sll1629 xla:403387 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.