TkA04G005130 | RubberDandelionOmics

Gene overview

TkA04G005130

Reference: TK1151 Chr: Chr04 Coordinates: 1227165-1229046 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1019 bp · TkA04G005130|TK1151|cDNA

TCAATTGTCGCTCTTTGATTTCAAATAAATAGCTTCAAAAGTCGAAAATTCAATAAAACTGATCAAAGTGTTACGATTCTTTAGATGGGTTTGAAGGTTAGAGCAGTAAACTGATGTCATTATCCGTCAACTAGCAGAAATCGAAGCCATGGTAATAATGCTACTTCAAAGAAGGTAATAACAAGAGACGAATGGGAGAAAAAGCTTAACGATGTTAAAATTCGAAAAGAAGACATGAACAAATTGGTGATGAATTTTCT...

CDS

Download CDS FASTA

648 bp · TkA04G005130|TK1151|CDS

ATGAACAAATTGGTGATGAATTTTCTTGTCACTGAGGGATATGTTGATGCAGCAGAAAAGTTCCGTATGGAATCTGGCACAGAACCAGATATAGATCTTGCAACAATTACAGACCGCATGGCTGTTAAAAAAGCAGTCCAGTCAGGAAACGTTGAAGATGCAATCGAAAAAGTCAATGATTTGAATCCCGAGATTCTAGATACAAATCCACAGCTATTTTTCCATCTACAACAACAAAGGCTGATAGAATTGATTAGAAA...

Protein

Download Protein FASTA

215 aa · TkA04G005130|TK1151|PROTEIN

MNKLVMNFLVTEGYVDAAEKFRMESGTEPDIDLATITDRMAVKKAVQSGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEENQSFLEELERTVALLAFEDVKNSPVSDLLDISQRLKTASEVNAAILTSQSHEKNPKLPSLLRMLYGHKISLMKRQLIHELPIFSQPHLKTLLFDLVKHWLTFKFDVLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G005130`
TK1151 ID	TkA04G005130
OH-1004 ID	LXL04_037082
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 89.212 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G005130

Location Chr04:1227165-1229046 (-)

Description Similar to GID8: Protein GID8 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61150`	Protein GID8 homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037082 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0048263 determination of dorsal identity Biological Process

GO:0090263 positive regulation of canonical Wnt signaling pathway Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0030054 cell junction Cellular Component

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G61150

ddi:DDB_G0279265

dre:566067

gga:419235

nve:5502962

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.535

Rank 1 · TkA04G005130 · TK1151

Nucleus0.441

Rank 2 · TkA04G005130 · TK1151

Mitochondrion0.094

Rank 3 · TkA04G005130 · TK1151

Golgi apparatus0.088

Rank 4 · TkA04G005130 · TK1151

Cell membrane0.073

Rank 5 · TkA04G005130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08513LisH1-25 aa

PF10607CTLH36-171 aa

PF03979Sigma70_r1_136-70 aa

PF19964EAD1141-66 aa

PF127294HB_MCP_145-59 aa

PF03979Sigma70_r1_176-97 aa

PF19964EAD1178-110 aa

PF127294HB_MCP_178-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G005130	`PF08513`	LisH	1	25	2.1e-08	34.5
TkA04G005130	`PF10607`	CTLH	36	171	2.8e-36	125.5
TkA04G005130	`PF03979`	Sigma70_r1_1	36	70	0.22	12.2
TkA04G005130	`PF19964`	EAD11	41	66	0.0043	17.7
TkA04G005130	`PF12729`	4HB_MCP_1	45	59	0.094	13.0
TkA04G005130	`PF03979`	Sigma70_r1_1	76	97	0.22	12.2
TkA04G005130	`PF19964`	EAD11	78	110	0.0043	17.7
TkA04G005130	`PF12729`	4HB_MCP_1	78	123	0.094	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WK5`	Arabidopsis thaliana	sp\|Q84WK5\|GID8_ARATH Protein GID8 homolog	86.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card