TkA04G002480 | RubberDandelionOmics

Gene overview

TkA04G002480

Reference: TK1151 Chr: Chr04 Coordinates: 629485-636922 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4973 bp · TkA04G002480|TK1151|cDNA

CTTAGGTCATTTTAGGACTGGTCTCTAAGCGCACTATCACATTCTTCAGTTCTATCAGGAAGGTATTAGTTTGGGAGAAACAAATAAGGAAGGATCGAATGGCATCACACTCGCACAGGAGACAAAGACCATATGGCATCCAAAACCCAGAAGATTAAAACATCGTTTCCTTTCTTAAAAAGGCTAAATAGATTTTCTTGCCATCTCCCTTCCTCTCTATCTCTATATATATGCAGCAGATAGATACGTTCTGTTGTATA...

CDS

Download CDS FASTA

4089 bp · TkA04G002480|TK1151|CDS

ATGGAGTTGGGACATCATACGTCTTTTGACAAGGCTGCGTCCACACCTTTGGGTTATTTAGATAGGGTGCATGGAAATGGAAATGGAAAGGTTCAACATCAATCAGAAAGTGAGATAGGGCGTGGTGTTGTAGGGGATATAGATGTAGACTCTAGAGAGATATACTTTTTGATAATGCATTTTCTATCTGGTGGGCCATGCCAAAGGACTTTTACACAGATGTGCAATGAACTTATGGAGTATCAGCTTTTGCCAAAGAG...

Protein

Download Protein FASTA

1362 aa · TkA04G002480|TK1151|PROTEIN

MELGHHTSFDKAASTPLGYLDRVHGNGNGKVQHQSESEIGRGVVGDIDVDSREIYFLIMHFLSGGPCQRTFTQMCNELMEYQLLPKRYHALYSRNGQVTGDETQTSNDAISFPLSYEGAAQRYCHISKDHLVKLLKQLIVNVAPARGIYGRTPPSAADVPTLLGMGPFSLLGGGSERGKGVAGYMRWPHMQADQVRGIRLREIGGGFPKHHRAPSIRLACYAIAKPSTMVQKMQNIKKLRGHRDAVYCAIFDRSGRYVIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G002480`
TK1151 ID	TkA04G002480
OH-1004 ID	LXL04_020148
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.100
Protein coverage (%)	TK1151 1.982 / OH-1004 26.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G002480`
Location	Chr04:629485-636922 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020148` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.938

Rank 1 · TkA04G002480 · TK1151

Cytoplasm0.157

Rank 2 · TkA04G002480 · TK1151

Cell membrane0.020

Rank 3 · TkA04G002480 · TK1151

Mitochondrion0.018

Rank 4 · TkA04G002480 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA04G002480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25437BRWD1_N46-141 aa

PF23775Beta-prop_RIG_2nd218-364 aa

PF30552CFAP251_N223-443 aa

PF25047Beta-prop_TEP1_2nd226-359 aa

PF29037DSE1_N227-296 aa

PF25174Beta-prop_THOC3230-319 aa

PF25175Beta-prop_WDR5230-366 aa

PF25173Beta-prop_WDR3_1st230-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G002480	`PF25437`	BRWD1_N	46	141	5e-28	97.9
TkA04G002480	`PF23775`	Beta-prop_RIG_2nd	218	364	3.3e-06	27.4
TkA04G002480	`PF30552`	CFAP251_N	223	443	7.1e-06	26.1
TkA04G002480	`PF25047`	Beta-prop_TEP1_2nd	226	359	5.6e-19	69.0
TkA04G002480	`PF29037`	DSE1_N	227	296	9.9e-12	45.3
TkA04G002480	`PF25174`	Beta-prop_THOC3	230	319	2e-48	165.5
TkA04G002480	`PF25175`	Beta-prop_WDR5	230	366	2.2e-47	162.5
TkA04G002480	`PF25173`	Beta-prop_WDR3_1st	230	413	1.4e-37	129.9
TkA04G002480	`PF24817`	WD40_WDHD1_1st	230	280	9.4e-28	97.9
TkA04G002480	`PF24807`	WD40_CDC20-Fz	230	365	1.7e-23	84.1
TkA04G002480	`PF23409`	Beta-prop_EML	230	312	1.7e-11	44.9
TkA04G002480	`PF23381`	Beta-prop_IFT122_1st	231	314	2.6e-37	129.4
TkA04G002480	`PF23414`	Beta-prop_EML_2	231	320	8.6e-18	65.4
TkA04G002480	`PF24796`	WDR55	231	410	3.5e-09	36.8
TkA04G002480	`PF23609`	Beta-prop_EIPR1	231	312	9.7e-05	22.7
TkA04G002480	`PF24797`	Beta-prop_WDR35_TULP_N	231	273	0.017	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card