TkA04G001340 | RubberDandelionOmics

Gene overview

TkA04G001340

Reference: TK1151 Chr: Chr04 Coordinates: 356421-358417 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1777 bp · TkA04G001340|TK1151|cDNA

GCCAAATTGCCAACAACATAAGAACACTATGTCACCGCACAATCTCCAGAACTTCGAAATTAAAAAACCCAGCCACAACAACAACCTCCCTTCTCCTCCCTCATTGTTCTCTCTTCCGTCCTTCATTCTAAACATCGCTGCTCCGGCGGAGATTGAGGGACGGAGTCCTGTCCGGCCAGGAGATAAAGAAGAGGATAATTAGGGGGGAAAGAGATAATGTACAGTGTATAAAAGCACCGACACCTAGTCTGGTCGGCGCA...

CDS

Download CDS FASTA

1098 bp · TkA04G001340|TK1151|CDS

ATGCAATGGATAATCAGATTTTCAGGTTTTGTATCCGCCACAATGGTCATGATTGTTCTAGCTCCTTCTCTCCAATCTTTTCATCCTGCTGAAGCCATTAGATCTTCTCATACTCATATTGGCGGCCACATCCGTCTTCCCGGTGGTCATATCCCAGGCAGCGCGACTTTTCGATCCTCCTTTCGTAAAGCTTCTACATTCCATAATGCTGCTGGATGTGAACCAAGCAGAGGCTCAGGGAATGTATGCGATCCGTCACT...

Protein

Download Protein FASTA

365 aa · TkA04G001340|TK1151|PROTEIN

MQWIIRFSGFVSATMVMIVLAPSLQSFHPAEAIRSSHTHIGGHIRLPGGHIPGSATFRSSFRKASTFHNAAGCEPSRGSGNVCDPSLVHVAITLDFEYLRGSIAAVHSILQHSSCPENIFFHFLVSDTGLKTLVGSTFPKLKFKVYYFDPEIVRKLISTSVRQALEQPLNYARNYLADILEACVARVIYLDSDLVVVDDVSKLWSTSLGEKTIGAPEYCHANFTKYFTAGFWSNRQYSSIFSNRNPCYFNTGVMVIDLSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G001340`
TK1151 ID	TkA04G001340
OH-1004 ID	LXL04_037126
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 82.955 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G001340

Location Chr04:356421-358417 (-)

Description Similar to GATL7: Probable galacturonosyltransferase-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62660`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g02720`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At4g02130`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At1g70090`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release
`At3g28340`	May be involved in pectin and/or xylans biosynthesis in cell walls.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037126 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048363 mucilage pectin metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0071668 plant-type cell wall assembly Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0047262 polygalacturonate 4-alpha-galacturonosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02720

ath:AT1G70090

ath:AT3G28340

ath:AT3G62660

ath:AT4G02130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.761

Rank 1 · TkA04G001340 · TK1151

Endoplasmic reticulum0.103

Rank 2 · TkA04G001340 · TK1151

Cytoplasm0.079

Rank 3 · TkA04G001340 · TK1151

Cell membrane0.065

Rank 4 · TkA04G001340 · TK1151

Extracellular0.057

Rank 5 · TkA04G001340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01501Glyco_transf_889-342 aa

PF18404Glyco_transf_24175-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G001340	`PF01501`	Glyco_transf_8	89	342	6e-59	200.4
TkA04G001340	`PF18404`	Glyco_transf_24	175	270	1.9e-06	28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYF4`	Arabidopsis thaliana	sp\|Q8VYF4\|GATL7_ARATH Probable galacturonosyltransferase-like 7	75.100%	Swiss-Prot	High
`Q9FWY9`	Arabidopsis thaliana	sp\|Q9FWY9\|GATL5_ARATH Probable galacturonosyltransferase-like 5	70.900%	Swiss-Prot	High
`O04253`	Arabidopsis thaliana	sp\|O04253\|GATL6_ARATH Probable galacturonosyltransferase-like 6	70.100%	Swiss-Prot	High
`O04536`	Arabidopsis thaliana	sp\|O04536\|GATL9_ARATH Probable galacturonosyltransferase-like 9	65.800%	Swiss-Prot	High
`Q9LHD2`	Arabidopsis thaliana	sp\|Q9LHD2\|GATLA_ARATH Probable galacturonosyltransferase-like 10	67.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card