Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2597 bp · TkA04G000170|TK1151|cDNA
CTTGGGACTCGCAATTTGGATTTCGACAAGGGATATTATTTCTGGAATCCGCGTATACCCCGTTTTGTCTTGATCATCAACTAATTTAGGTAAACTACCCTTCTGCATCGACTTCGACTGCTTGTTAACGCCCATCTCCATAATCGCTCATCCCTCTGCCTAATGCTGAAGACGACCGGTTCTTCCCTCCCATAGATATCTTCCGATTTCCCTCAGGCACGGTGGTATTCAAGTTGGAGAGAGCCACCGATTTGTCATCG...
2001 bp · TkA04G000170|TK1151|CDS
ATGGAGGGAGTGGATTACTTGACTGATGAGAGGAAGACGGCGCAGTTCGATATAGAAGCCATGAAAGTTGCTTGGGCAGGTTCTCGTGAAACTCTTGAAGTATCTGATCGTATGGCCAAGCTCGTTGCGAATGATCCTGTCTTTGAGAAGTTTTCGAGGCCTATGCTTGGTAGGAAAGAGTTGTTCAAGAACACACTTAGAAAAGCTGCTTATGCGTGGAAGTTGATTGTCAGCCTTGGTCTATCTGAAGAAGAGGCCAA...
Protein
Download Protein FASTA666 aa · TkA04G000170|TK1151|PROTEIN
MEGVDYLTDERKTAQFDIEAMKVAWAGSRETLEVSDRMAKLVANDPVFEKFSRPMLGRKELFKNTLRKAAYAWKLIVSLGLSEEEAKWLRLYIDEPAFTDLHWGMFIPAIEGQGTEEQKQKWLPLAKKMQIIGCYAQTELGHGSNVQGLETTATFDPQTDEFVLDSPTLTSSKWWPGGLGKVSTHAIVYARLIVGGQFHGVHGFIVQLRSLEDHSPVDGITVGDIGLKFGNGAYNTMDNGVLRFDHVRIPRNQMLMRVSQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G000170 |
|---|---|
| TK1151 ID | TkA04G000170 |
| OH-1004 ID | LXL04_026610 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G000170 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:34940-40776 (+) | |||||||||
| Description | Similar to ACX1: Peroxisomal acyl-coenzyme A oxidase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000038 very long-chain fatty acid metabolic process Biological Process GO:0001676 long-chain fatty acid metabolic process Biological Process GO:0006091 generation of precursor metabolites and energy Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006633 fatty acid biosynthetic process Biological Process GO:0006635 fatty acid beta-oxidation Biological Process GO:0007283 spermatogenesis Biological Process GO:0009062 fatty acid catabolic process Biological Process GO:0009611 response to wounding Biological Process GO:0009620 response to fungus Biological Process GO:0009695 jasmonic acid biosynthetic process Biological Process GO:0016559 peroxisome fission Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G35690 ath:AT4G16760 mmu:11430 rno:50681 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14749Acyl-CoA_ox_N17-132 aaPF02771Acyl-CoA_dh_N99-124 aaPF02770Acyl-CoA_dh_M134-236 aaPF22924ACOX_C_alpha1278-439 aaPF00441Acyl-CoA_dh_1280-438 aaPF17785PUA_3469-499 aaPF01756ACOX479-656 aaPF17785PUA_3561-580 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA04G000170 | PF14749 | Acyl-CoA_ox_N | 17 | 132 | 7.9e-33 | 114.2 |
| TkA04G000170 | PF02771 | Acyl-CoA_dh_N | 99 | 124 | 0.009 | 17.1 |
| TkA04G000170 | PF02770 | Acyl-CoA_dh_M | 134 | 236 | 6.7e-08 | 33.3 |
| TkA04G000170 | PF22924 | ACOX_C_alpha1 | 278 | 439 | 1.8e-67 | 227.1 |
| TkA04G000170 | PF00441 | Acyl-CoA_dh_1 | 280 | 438 | 0.0024 | 18.7 |
| TkA04G000170 | PF17785 | PUA_3 | 469 | 499 | 0.0098 | 16.4 |
| TkA04G000170 | PF01756 | ACOX | 479 | 656 | 4.4e-53 | 180.3 |
| TkA04G000170 | PF17785 | PUA_3 | 561 | 580 | 0.0098 | 16.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.