TkA03G609160 | RubberDandelionOmics

Gene overview

TkA03G609160

Reference: TK1151 Chr: Chr03 Coordinates: 154689743-154690271 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

309 bp · TkA03G609160|TK1151|cDNA

ATGGAGCAACTATCAGGTGGGGAAAAGACCGTTGCAGCCCTTGCTTTACTTTTCTCCATCCACAGTTACAAGCCATCACCGTTCTTTATACTGGATGAGGTGGACGCAGCACTAGATAATTTAAATGTTGCTAGGGTTGCTGAATTCATTAGATCAAAAGCGTATGATGAGGGTTTACAGAGTATTGTGATCTCACTCAAGGATAGCTTTTACAGCAAGGCACAAGCAATGGTTGGGGTTTACAGGGATTTTAAAACAGG...

CDS

Download CDS FASTA

309 bp · TkA03G609160|TK1151|CDS

ATGGAGCAACTATCAGGTGGGGAAAAGACCGTTGCAGCCCTTGCTTTACTTTTCTCCATCCACAGTTACAAGCCATCACCGTTCTTTATACTGGATGAGGTGGACGCAGCACTAGATAATTTAAATGTTGCTAGGGTTGCTGAATTCATTAGATCAAAAGCGTATGATGAGGGTTTACAGAGTATTGTGATCTCACTCAAGGATAGCTTTTACAGCAAGGCACAAGCAATGGTTGGGGTTTACAGGGATTTTAAAACAGG...

Protein

Download Protein FASTA

102 aa · TkA03G609160|TK1151|PROTEIN

MEQLSGGEKTVAALALLFSIHSYKPSPFFILDEVDAALDNLNVARVAEFIRSKAYDEGLQSIVISLKDSFYSKAQAMVGVYRDFKTGCSRTLTIDLTKYPES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G609160`
TK1151 ID	TkA03G609160
OH-1004 ID	LXL04_011654
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 8.416 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G609160

Location Chr03:154689743-154690271 (-)

Description Similar to SMC1: Structural maintenance of chromosomes protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54670`	Central component of cohesin, a complex required for chromosome cohesion during the cell cycle.	Condensin and cohesin knockouts in Arabidopsis exhibit a titan seed phenotype.2002 · DOI: 10.1046/j.1365-313x.2002.01224.x Cohesin gene defects may impair sister chromatid alignment and genome stability in Arabidopsis thaliana.2009 · DOI: 10.1007/s00412-009-0220-x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011654 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0006281 DNA repair Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0009314 response to radiation Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0034087 establishment of mitotic sister chromatid cohesion Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0072423 response to DNA damage checkpoint signaling Biological Process

GO:0090307 mitotic spindle assembly Biological Process

KEGG gene cross-reference

ath:AT3G54670

bta:282370

hsa:8243

mmu:24061

rno:63996

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.650

Rank 1 · TkA03G609160 · TK1151

Nucleus0.329

Rank 2 · TkA03G609160 · TK1151

Cell membrane0.103

Rank 3 · TkA03G609160 · TK1151

Lysosome / Vacuole0.064

Rank 4 · TkA03G609160 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA03G609160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02463SMC_N2-82 aa

PF13558SbcC_Walker_B2-51 aa

PF13304AAA_213-62 aa

PF10088DUF232622-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G609160	`PF02463`	SMC_N	2	82	9.6e-27	94.6
TkA03G609160	`PF13558`	SbcC_Walker_B	2	51	0.029	15.3
TkA03G609160	`PF13304`	AAA_21	3	62	0.00014	22.6
TkA03G609160	`PF10088`	DUF2326	22	72	0.043	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6Q1P4`	Arabidopsis thaliana	sp\|Q6Q1P4\|SMC1_ARATH Structural maintenance of chromosomes protein 1	70.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card