Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1364 bp · TkA03G608620|TK1151|cDNA
GTTCCAACAAACCCCACCAGTCACCAGCCACCAGCCCTACTGCTTTATGACGTATTTAATATCTCTGATTACAAAACCCATATTTTAGATCCAATCTTTTCCCCCAATTTCCAAAGCAAACTCCATCAAAATGGTGCTCTCATTCTTGGAGACGCTCAAAACACAGCCTTTATGGCTAAATTTCGTGTTTGCGTTGGGTTTTTTATCTTTCCTCAAGACTTCGACTTCAATCATCAGATGGGTTTATGTTAATTTCCTTA...
963 bp · TkA03G608620|TK1151|CDS
ATGGTGCTCTCATTCTTGGAGACGCTCAAAACACAGCCTTTATGGCTAAATTTCGTGTTTGCGTTGGGTTTTTTATCTTTCCTCAAGACTTCGACTTCAATCATCAGATGGGTTTATGTTAATTTCCTTAGACCTTCAAAGAATCTCAAGAAATACGGATCATGGGCACTTGTTACTGGCTCCACCGACGGCATTGGTAAAGCTTTTGCATTCGAATTAGCTAAAAAGGGTATTAATTTGATCTTGGTGGGTCGAAACCC...
Protein
Download Protein FASTA320 aa · TkA03G608620|TK1151|PROTEIN
MVLSFLETLKTQPLWLNFVFALGFLSFLKTSTSIIRWVYVNFLRPSKNLKKYGSWALVTGSTDGIGKAFAFELAKKGINLILVGRNPSKLEGVSSEIKSKFDKTQIKEVVFDLSGDLFEGIKKITESIDGLDIGILINNAGVSYPYARFFHEVDEELLNNLIKVNVEATTRVTQAVLPGMVKRKRGAIVNIGSGAAIVIPSDPLYAVYAATKAYVDQFSRCLYVEYKNSGIDVQCQVPLYVATKMASIKRSSFFVPSASG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G608620 |
|---|---|
| TK1151 ID | TkA03G608620 |
| OH-1004 ID | LXL04_011649 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G608620 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:154551226-154552775 (-) | |||||||||
| Description | Similar to KCR1: Very-long-chain 3-oxoacyl-CoA reductase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006694 steroid biosynthetic process Biological Process GO:0006702 androgen biosynthetic process Biological Process GO:0006703 estrogen biosynthetic process Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0019367 fatty acid elongation, saturated fatty acid Biological Process GO:0030497 fatty acid elongation Biological Process GO:0035338 long-chain fatty-acyl-CoA biosynthetic process Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0009507 chloroplast Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G24470 ath:AT1G67730 cci:CC1G_02019 gga:415703 hsa:51144 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00106adh_short55-247 aaPF08659KR55-220 aaPF01370Epimerase56-195 aaPF02719Polysacc_synt_257-179 aaPF13561adh_short_C262-247 aaPF00861Ribosomal_L18p64-92 aaPF00861Ribosomal_L18p85-121 aaPF25471TM_PetC140-150 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G608620 | PF00106 | adh_short | 55 | 247 | 4.6e-41 | 141.2 |
| TkA03G608620 | PF08659 | KR | 55 | 220 | 2e-06 | 28.6 |
| TkA03G608620 | PF01370 | Epimerase | 56 | 195 | 0.14 | 12.3 |
| TkA03G608620 | PF02719 | Polysacc_synt_2 | 57 | 179 | 0.037 | 13.9 |
| TkA03G608620 | PF13561 | adh_short_C2 | 62 | 247 | 9e-23 | 81.8 |
| TkA03G608620 | PF00861 | Ribosomal_L18p | 64 | 92 | 0.12 | 13.5 |
| TkA03G608620 | PF00861 | Ribosomal_L18p | 85 | 121 | 0.12 | 13.5 |
| TkA03G608620 | PF25471 | TM_PetC | 140 | 150 | 0.34 | 11.4 |
| TkA03G608620 | PF25471 | TM_PetC | 252 | 265 | 0.34 | 11.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.