TkA03G600080 | RubberDandelionOmics

Gene overview

TkA03G600080

Reference: TK1151 Chr: Chr03 Coordinates: 152372621-152375894 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1808 bp · TkA03G600080|TK1151|cDNA

GAATGATGCAAACTTCATCACTGTTCAAGATTCCAGTAGGGTCCGCTGTTCCTATCAAATAGAAGCTTTCATCTACCGGAAGCTTCCCACCACAAAGACCCTTTCGTTCTTCATTTTCTAAAATTGACAAACAGTATTGAAGATACGGTTCATCAAGTGGAGTTCCAGACCCAATCATTGCTACTGAAGTTGCTGAATCATCCATTTGTCCATAATTAAGACCCACTACACAAACAACCAAAACAGGTTTAAGCTGGAAG...

CDS

Download CDS FASTA

1107 bp · TkA03G600080|TK1151|CDS

ATGGAGTGTGCCGCGAAGGGAGGTCAACGGCGGTGCTCGGGCTCAGCTAACCGCCGGTGCGGTGGTTGTGGTACCGTTTTCTATTGCTCCGTCTCTCATCAGACATCACATTGGGGAGTTCACAAAGAAGAATGTGGAAGACTCAAACAACAAATGTCTAGTATGCTACTGCTAAATGACTTCCCCTTTACTTTTTCCCGAGAGGCTACTCATCAGGTGTGTGAAAAAGTGGAGACCAGATGCTCATTTTTGGAAAAACA...

Protein

Download Protein FASTA

368 aa · TkA03G600080|TK1151|PROTEIN

MECAAKGGQRRCSGSANRRCGGCGTVFYCSVSHQTSHWGVHKEECGRLKQQMSSMLLLNDFPFTFSREATHQVCEKVETRCSFLEKQGIHRVGLWICECRCGDSINLSDHIRSDNAWSLSNKLCPCKGPLCILNKQLTSWNDYYEWRDIPLHSPVALLLHWPLTIYQSIQLALSKQLISETTDELWIHYLGPEMELYQLAVFGELHALLPAVRVHIDFVGPGIPHDRNGERTTLCSYAHCTEVDCRCKSSKSEFISPITV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G600080`
TK1151 ID	TkA03G600080
OH-1004 ID	LXL04_011541
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G600080`
Location	Chr03:152372621-152375894 (+)
Description	Similar to ZMYND15: Zinc finger MYND domain-containing protein 15
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011541` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0007286 spermatid development Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0042826 histone deacetylase binding Molecular Function
KEGG gene cross-reference	hsa:84225 mmu:574428 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · TkA03G600080 · TK1151

Nucleus0.395

Rank 2 · TkA03G600080 · TK1151

Mitochondrion0.092

Rank 3 · TkA03G600080 · TK1151

Cell membrane0.068

Rank 4 · TkA03G600080 · TK1151

Golgi apparatus0.057

Rank 5 · TkA03G600080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01753zf-MYND11-45 aa

PF24324MYND_ZMYND11_ZMYD812-45 aa

PF20179MSS51_C162-350 aa

PF01753zf-MYND244-249 aa

PF24324MYND_ZMYND11_ZMYD8314-321 aa

PF01753zf-MYND315-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G600080	`PF01753`	zf-MYND	11	45	2.2e-09	37.9
TkA03G600080	`PF24324`	MYND_ZMYND11_ZMYD8	12	45	0.0078	17.0
TkA03G600080	`PF20179`	MSS51_C	162	350	1.1e-36	127.1
TkA03G600080	`PF01753`	zf-MYND	244	249	2.2e-09	37.9
TkA03G600080	`PF24324`	MYND_ZMYND11_ZMYD8	314	321	0.0078	17.0
TkA03G600080	`PF01753`	zf-MYND	315	321	2.2e-09	37.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card