TkA03G594200 | RubberDandelionOmics

Gene overview

TkA03G594200

Reference: TK1151 Chr: Chr03 Coordinates: 150896664-150898546 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1127 bp · TkA03G594200|TK1151|cDNA

CCATGTGAAATAGTTTCATCCCCACCGATTCACTTTCAACAGATTGTGTCGTAGCTAAAGACGACACACATTACCCCCTTCTCATCACTTCTCTCGGACAAAATACTCACACAAAAACATTCACATCTTTAGAGCACGAAGAACAGAGATGGGGAAAGGTCCAGGTCTCTACCCTGATATCGGCAAAAAAGCCAGAGATCTTCTCTACAGGGATTACCAGAGCGACCATAAGTTTTCTCTCACAACATTCACCGTCAACG...

CDS

Download CDS FASTA

831 bp · TkA03G594200|TK1151|CDS

ATGGGGAAAGGTCCAGGTCTCTACCCTGATATCGGCAAAAAAGCCAGAGATCTTCTCTACAGGGATTACCAGAGCGACCATAAGTTTTCTCTCACAACATTCACCGTCAACGGCGTTTCAATCACCTCATCAGGATCTAAGAAAGGCGATTTTTTTTTAGCTGATGTCAACACAAAACTCATCAACAAAAACATCACAACCGATGTCAAAGTGGACACAAACTCCAAGGTTTTCACAACCATCACCATTGATGAACCTGC...

Protein

Download Protein FASTA

276 aa · TkA03G594200|TK1151|PROTEIN

MGKGPGLYPDIGKKARDLLYRDYQSDHKFSLTTFTVNGVSITSSGSKKGDFFLADVNTKLINKNITTDVKVDTNSKVFTTITIDEPAPGLKTIFSFVVPDQKSGKVELQYLHENAGISTSIGLTASPIVNFSGVAGNNTVALGTDISFDTASGNFTKYNAGISFTTSDLIASLSVNDKGDTLTASYYHTVSPLTNTAVGAELTHGFTSNENSLTIGTQHSLDPLTSVKARVNNFGIASALLQHEWRPKSVFTISGEVDTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G594200`
TK1151 ID	TkA03G594200
OH-1004 ID	LXL04_011499
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G594200

Location Chr03:150896664-150898546 (+)

Description Similar to Mitochondrial outer membrane protein porin of 36 kDa

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01280`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	Molecular and genetic characterization of the gene family encoding the voltage-dependent anion channel in Arabidopsis.2011 · DOI: 10.1093/jxb/err113

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0361400`	Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011499 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009527 plastid outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0046930 pore complex Cellular Component

KEGG gene cross-reference

ath:AT3G01280

dosa:Os09g0361400

sot:102580103

sot:102603136

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.857

Rank 1 · TkA03G594200 · TK1151

Cytoplasm0.095

Rank 2 · TkA03G594200 · TK1151

Plastid0.068

Rank 3 · TkA03G594200 · TK1151

Cell membrane0.057

Rank 4 · TkA03G594200 · TK1151

Nucleus0.048

Rank 5 · TkA03G594200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01459Porin_34-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G594200	`PF01459`	Porin_3	4	269	1.5e-85	287.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRH5`	Arabidopsis thaliana	sp\|Q9SRH5\|VDAC1_ARATH Mitochondrial outer membrane protein porin 1	71.700%	Swiss-Prot	High
`Q6K548`	Oryza sativa subsp. japonica	sp\|Q6K548\|VDAC1_ORYSJ Mitochondrial outer membrane protein porin 1	68.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card