TkA03G588750 | RubberDandelionOmics

Gene overview

TkA03G588750

Reference: TK1151 Chr: Chr03 Coordinates: 149567855-149568217 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · TkA03G588750|TK1151|cDNA

ATGCCTGTTCGTGTCACCTACAGAGATCTTCAAGAAGCAACGAATGATTTCACAACAAAGCTAGGGCAAGGCGGATTCAGTTCAGTCTACAAAGGTGCCCTAAAAGATGGAACGTCAATCGCGGTCAAGCGGCTAGAGGGACTCGGGCAGGGGAAGAAAGAGTTTCGAGCAGAAGTGAGCATAATCAGAAGCATCCATCACCACCATTTGGTAAAACTCAAAGGATTTTGTGCAGAATCAAAGCATCGTCTTCTCGTTTA...

CDS

Download CDS FASTA

363 bp · TkA03G588750|TK1151|CDS

ATGCCTGTTCGTGTCACCTACAGAGATCTTCAAGAAGCAACGAATGATTTCACAACAAAGCTAGGGCAAGGCGGATTCAGTTCAGTCTACAAAGGTGCCCTAAAAGATGGAACGTCAATCGCGGTCAAGCGGCTAGAGGGACTCGGGCAGGGGAAGAAAGAGTTTCGAGCAGAAGTGAGCATAATCAGAAGCATCCATCACCACCATTTGGTAAAACTCAAAGGATTTTGTGCAGAATCAAAGCATCGTCTTCTCGTTTA...

Protein

Download Protein FASTA

120 aa · TkA03G588750|TK1151|PROTEIN

MPVRVTYRDLQEATNDFTTKLGQGGFSSVYKGALKDGTSIAVKRLEGLGQGKKEFRAEVSIIRSIHHHHLVKLKGFCAESKHRLLVYEYMANGSLDRWIFGKYLTMVVCVGMAVGNRYAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G588750`
TK1151 ID	TkA03G588750
OH-1004 ID	LXL04_005317
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.900
Protein coverage (%)	TK1151 98.333 / OH-1004 14.643 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G588750

Location Chr03:149567855-149568217 (-)

Description Similar to SD25: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5.	No verified direct reference in this release
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005317 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G34300

ath:AT2G19130

ath:AT4G32300

ath:AT5G24080

ath:AT5G35370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.539

Rank 1 · TkA03G588750 · TK1151

Cytoplasm0.342

Rank 2 · TkA03G588750 · TK1151

Nucleus0.239

Rank 3 · TkA03G588750 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA03G588750 · TK1151

Plastid0.035

Rank 5 · TkA03G588750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr17-99 aa

PF00069Pkinase19-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G588750	`PF07714`	PK_Tyr_Ser-Thr	17	99	7.8e-17	62.1
TkA03G588750	`PF00069`	Pkinase	19	99	1.6e-15	57.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWZ5`	Arabidopsis thaliana	sp\|Q8RWZ5\|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5	70.600%	Swiss-Prot	High
`Q9XID3`	Arabidopsis thaliana	sp\|Q9XID3\|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	51.300%	Swiss-Prot	High
`Q9FLV4`	Arabidopsis thaliana	sp\|Q9FLV4\|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	57.100%	Swiss-Prot	High
`O64477`	Arabidopsis thaliana	sp\|O64477\|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	51.200%	Swiss-Prot	High
`Q9ZUE0`	Arabidopsis thaliana	sp\|Q9ZUE0\|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card