TkA03G586320 | RubberDandelionOmics

Gene overview

TkA03G586320

Reference: TK1151 Chr: Chr03 Coordinates: 148962254-148968660 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2626 bp · TkA03G586320|TK1151|cDNA

ATCTAACAAACAATGGAGGCTTTTCGTGAGGAGTTTCAACATCTAAAACACTTTAACTTGAGTGAGATAAAGTCGATCACAGGCGACTTTGATAAGAAGAATATTATCGGAGAAGGTGGATTTGGGAAAGTGTATGGAGGACTAATCTCTGAATCTAACTCTCAGAGGCAAGTCATGGCTGCTTTCAAGCGTCTAGATAGCAGTTGTGGGCAAGGAGACCCTGAGTTCTTAAAAGAGATCATGTTGCTTTCCTGTTATAC...

CDS

Download CDS FASTA

2487 bp · TkA03G586320|TK1151|CDS

ATGGAGGCTTTTCGTGAGGAGTTTCAACATCTAAAACACTTTAACTTGAGTGAGATAAAGTCGATCACAGGCGACTTTGATAAGAAGAATATTATCGGAGAAGGTGGATTTGGGAAAGTGTATGGAGGACTAATCTCTGAATCTAACTCTCAGAGGCAAGTCATGGCTGCTTTCAAGCGTCTAGATAGCAGTTGTGGGCAAGGAGACCCTGAGTTCTTAAAAGAGATCATGTTGCTTTCCTGTTATACACATGAAAATCT...

Protein

Download Protein FASTA

828 aa · TkA03G586320|TK1151|PROTEIN

MEAFREEFQHLKHFNLSEIKSITGDFDKKNIIGEGGFGKVYGGLISESNSQRQVMAAFKRLDSSCGQGDPEFLKEIMLLSCYTHENLISLLGFCTQDGEKILVYEHASHGSLDVHLSSSSLTWTQRLKICLGAARGLCYLHDPNETQQRVIHRDIKSSNILLDNNWNAKVSDMGLAKIGPTNQLHSFLATNVVGTFFYMDPMYMETSILTKESDVYSFGVVLFEVLCGRLCFEYENGRPRSLVRKWKTSYKEKKLEEIIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G586320`
TK1151 ID	TkA03G586320
OH-1004 ID	LXL04_011396
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G586320

Location Chr03:148962254-148968660 (-)

Description Similar to At5g38990: Probable receptor-like protein kinase At5g38990

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At1g30570`	Probable receptor-like protein kinase At1g30570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011396 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0030308 negative regulation of cell growth Biological Process

KEGG gene cross-reference

ath:AT1G30570

ath:AT3G51550

ath:AT5G28680

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.572

Rank 1 · TkA03G586320 · TK1151

Nucleus0.334

Rank 2 · TkA03G586320 · TK1151

Cell membrane0.232

Rank 3 · TkA03G586320 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA03G586320 · TK1151

Lysosome / Vacuole0.045

Rank 5 · TkA03G586320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-298 aa

PF07714PK_Tyr_Ser-Thr29-300 aa

PF00069Pkinase348-378 aa

PF14299PP2500-591 aa

PF14299PP2671-827 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G586320	`PF00069`	Pkinase	27	298	1.4e-39	136.8
TkA03G586320	`PF07714`	PK_Tyr_Ser-Thr	29	300	9.7e-43	147.0
TkA03G586320	`PF00069`	Pkinase	348	378	1.4e-39	136.8
TkA03G586320	`PF14299`	PP2	500	591	5.1e-24	85.7
TkA03G586320	`PF14299`	PP2	671	827	5.1e-24	85.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	44.000%	Swiss-Prot	Low
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	44.000%	Swiss-Prot	Low
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	45.000%	Swiss-Prot	Low
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	43.400%	Swiss-Prot	Low
`Q9SA72`	Arabidopsis thaliana	sp\|Q9SA72\|Y1357_ARATH Probable receptor-like protein kinase At1g30570	43.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card