Gene Card
Gene overview
cDNA / CDS / Protein Sequences
312 bp · TkA03G581730|TK1151|cDNA
ATGCCAGACTCGGTCCGTGGTCCGACGTTTTGCCTCAGACTCGGTCCGTGTATAAAAATCGACAAACTGAGTTTTTTGCCTGTGATGTCGGACTCGGTCCGTGGTCCGAGGCGTTTGATAGGAGAGTTTGATGTCGGACTCGGTCCGTGGTCCGTGGTCCGTGGTCTGAGTCCGAGTCCGAGTCCGTGGTGCAATCAAACACACCCTTACTTTGTATACATGGGCGGACGCAAGAAGGAACCAATGTGGTCACTTGTCCT...
312 bp · TkA03G581730|TK1151|CDS
ATGCCAGACTCGGTCCGTGGTCCGACGTTTTGCCTCAGACTCGGTCCGTGTATAAAAATCGACAAACTGAGTTTTTTGCCTGTGATGTCGGACTCGGTCCGTGGTCCGAGGCGTTTGATAGGAGAGTTTGATGTCGGACTCGGTCCGTGGTCCGTGGTCCGTGGTCTGAGTCCGAGTCCGAGTCCGTGGTGCAATCAAACACACCCTTACTTTGTATACATGGGCGGACGCAAGAAGGAACCAATGTGGTCACTTGTCCT...
Protein
Download Protein FASTA103 aa · TkA03G581730|TK1151|PROTEIN
MPDSVRGPTFCLRLGPCIKIDKLSFLPVMSDSVRGPRRLIGEFDVGLGPWSVVRGLSPSPSPWCNQTHPYFVYMGGRKKEPMWSLVLNALIYFSLDIYLELFV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G581730 |
|---|---|
| TK1151 ID | TkA03G581730 |
| OH-1004 ID | LXL04_017686 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 93.900 |
| Protein coverage (%) | TK1151 45.631 / OH-1004 6.759Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G581730 |
|---|---|
| Location | Chr03:147675853-147676164 (-) |
| Description | Similar to MBD4L: Methyl-CpG-binding domain protein 4-like protein |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006284 base-excision repair Biological Process GO:0006974 DNA damage response Biological Process GO:0006979 response to oxidative stress Biological Process GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process GO:0009314 response to radiation Biological Process GO:0009408 response to heat Biological Process GO:0032355 response to estradiol Biological Process GO:0034605 cellular response to heat Biological Process GO:0045008 depyrimidination Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component |
| KEGG gene cross-reference | ath:AT3G07930 hsa:8930 mmu:17193 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.