TkA03G577920 | RubberDandelionOmics

Gene overview

TkA03G577920

Reference: TK1151 Chr: Chr03 Coordinates: 146587307-146592246 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4143 bp · TkA03G577920|TK1151|cDNA

TTTGCCTACAATACTACAAGGCATCGTGAAGTTTTGACAGCGATGCTTGCTTCGTTCAAAACAACCAAAATACCCAATCTCAAACCCTAACCTTCCATTTTCACAGTCACGGCGATAGCAATGGCGGCTAGAATGGCTCGATCGCTTCTATCCCTCCGATCATCACCTTCCATGCACTCAACCGGCTTCGCTCCCTCCTCCATATCATCTCTCTCTGACTCTCTCAACGCTCTTAATCTGAACAGATCAGCTGGTTCGTC...

CDS

Download CDS FASTA

1680 bp · TkA03G577920|TK1151|CDS

ATGGCAGCAGTTGAAAGTAATACCACCATGCAACCAAAGACCAATGCCACCGTGGAACCAGTCCGCCCTTTAGCCAACTTTCCTCCTTCTGTATGGGGTGATCGCTTCCTATCCTTCACTCTTGATAATTCGGAATTGGAAGGCTATGCGAAAGCCATGGAAGAGCCAAAAGAAGAATTGAGAAGATTGATCGTAGACCCAACAATGGATTCCAACACGAAACTTAGTTTGATTTACTCTGTTCATCGTCTTGGTTTAAC...

Protein

Download Protein FASTA

559 aa · TkA03G577920|TK1151|PROTEIN

MAAVESNTTMQPKTNATVEPVRPLANFPPSVWGDRFLSFTLDNSELEGYAKAMEEPKEELRRLIVDPTMDSNTKLSLIYSVHRLGLTYMFLKEIEAQLDKLFKDFNLQDYQEFDLYTISINFQVFRHLGYKLPCDVFNKFKDSSSGTFKECVTKDVKGMLGLYESAQLRLRGEEILDEAATFTVTQLKSVVNTLEGKLEQQVMQSLRRPFHQGMPMVEARFYFANYDEECSTHESLTKLAKLHFNYLQLQEKEELRIVSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G577920`
TK1151 ID	TkA03G577920
OH-1004 ID	LXL04_034492
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	54.400
Protein coverage (%)	TK1151 96.422 / OH-1004 96.810 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G577920`
Location	Chr03:146587307-146592246 (+)
Description	Similar to Germacrene A synthase short form
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034492` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016102 diterpenoid biosynthetic process Biological Process GO:0045338 farnesyl diphosphate metabolic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0000287 magnesium ion binding Molecular Function GO:0010334 sesquiterpene synthase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0034005 germacrene-A synthase activity Molecular Function
KEGG gene cross-reference	ag:AAM21659 ag:AMQ26035 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.669

Rank 1 · TkA03G577920 · TK1151

Plastid0.266

Rank 2 · TkA03G577920 · TK1151

Nucleus0.151

Rank 3 · TkA03G577920 · TK1151

Endoplasmic reticulum0.069

Rank 4 · TkA03G577920 · TK1151

Cell membrane0.056

Rank 5 · TkA03G577920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01397Terpene_synth31-206 aa

PF00566RabGAP-TBC98-142 aa

PF00566RabGAP-TBC210-260 aa

PF02223Thymidylate_kin232-255 aa

PF19086Terpene_syn_C_2233-278 aa

PF03936Terpene_synth_C263-502 aa

PF19086Terpene_syn_C_2303-502 aa

PF00566RabGAP-TBC306-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G577920	`PF01397`	Terpene_synth	31	206	5.6e-44	150.8
TkA03G577920	`PF00566`	RabGAP-TBC	98	142	0.87	9.9
TkA03G577920	`PF00566`	RabGAP-TBC	210	260	0.87	9.9
TkA03G577920	`PF02223`	Thymidylate_kin	232	255	0.043	14.2
TkA03G577920	`PF19086`	Terpene_syn_C_2	233	278	3.2e-48	164.8
TkA03G577920	`PF03936`	Terpene_synth_C	263	502	8.7e-86	287.9
TkA03G577920	`PF19086`	Terpene_syn_C_2	303	502	3.2e-48	164.8
TkA03G577920	`PF00566`	RabGAP-TBC	306	377	0.87	9.9
TkA03G577920	`PF02223`	Thymidylate_kin	333	395	0.043	14.2
TkA03G577920	`PF02223`	Thymidylate_kin	443	473	0.043	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card