TkA03G575500 | RubberDandelionOmics

Gene overview

TkA03G575500

Reference: TK1151 Chr: Chr03 Coordinates: 145957062-145960743 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2323 bp · TkA03G575500|TK1151|cDNA

GTCATCTCCTCGGCGTTCGTGCCTCCCCCGGTTGTCTATTCAAAAACAAAATAAGGAATCTCTCTCCATTTATCTGCTTATAAATAACCCCTTTTTAAATCTGCAATCTCTTCTAGGCGTTACCGCTTTTCAAATTTATAAAGAAATTTGGGTTGGGAAACCCCCCAATTTCAATTCACATTTACGATTGGGTTATTTTAATCCTTATCAAAATCTCCAAGCTTGTATGTGCATATATTGAAACCAGGGCTCGTTTGGAA...

CDS

Download CDS FASTA

1764 bp · TkA03G575500|TK1151|CDS

ATGGAGAGATTTGCTCCGGTGGGGATGACGGTCTCGGCGTTTGTGAAGTGGGAAGAAGTTTTTTCTACAAACCATAGAGGAAGAAGAGAGGTACGGTATTATCTGAAACGGCGGGATGGGACTTCCGATTTGGCAGTTGTCGGCAAAGAGAAGAAATCAGGGTCCAAAATGAAGACGTCTCCGTTGGTCTCTTCTTCCTATCGTTATCGATACGCAATTCGTGACAAATCGCTCTTTCCGTCATCTGAAATTTTTACCAA...

Protein

Download Protein FASTA

587 aa · TkA03G575500|TK1151|PROTEIN

MERFAPVGMTVSAFVKWEEVFSTNHRGRREVRYYLKRRDGTSDLAVVGKEKKSGSKMKTSPLVSSSYRYRYAIRDKSLFPSSEIFTKLRSRRQVIDWLSSLVTDGSFSQPPKIIEAGDTLKSKSENFQDVHLHKSIIHQTPDLQWVGSFTFKKKRKHYEAYTRSGVKISVDDFVYVLAEEDKRLVAHLEDLYQDSKGNKVAVVRWFHKVDEVFGIDHHHKPHNPYYNINNNHKEIFFSLCAQDLNIECIDGPATVLTPQH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G575500`
TK1151 ID	TkA03G575500
OH-1004 ID	LXL04_011238
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G575500`
Location	Chr03:145957062-145960743 (-)
Description	Similar to DUF3: DUF724 domain-containing protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011238` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0009651 response to salt stress Biological Process GO:0009934 regulation of meristem structural organization Biological Process GO:0010468 regulation of gene expression Biological Process GO:0071555 cell wall organization Biological Process GO:2000280 regulation of root development Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0000775 chromosome, centromeric region Cellular Component GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0042393 histone binding Molecular Function
KEGG gene cross-reference	ath:AT1G09320 ath:AT1G11420 ath:AT1G26540 ath:AT4G17330 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · TkA03G575500 · TK1151

Cytoplasm0.067

Rank 2 · TkA03G575500 · TK1151

Cell membrane0.026

Rank 3 · TkA03G575500 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA03G575500 · TK1151

Plastid0.014

Rank 5 · TkA03G575500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16771RTT107_BRCT_6165-215 aa

PF01426BAH167-285 aa

PF10978DUF2785176-232 aa

PF05641Agenet341-414 aa

PF05641Agenet425-471 aa

PF16771RTT107_BRCT_6507-537 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G575500	`PF16771`	RTT107_BRCT_6	165	215	0.25	12.2
TkA03G575500	`PF01426`	BAH	167	285	3.9e-08	33.9
TkA03G575500	`PF10978`	DUF2785	176	232	0.12	12.8
TkA03G575500	`PF05641`	Agenet	341	414	9.4e-18	65.2
TkA03G575500	`PF05641`	Agenet	425	471	9.4e-18	65.2
TkA03G575500	`PF16771`	RTT107_BRCT_6	507	537	0.25	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card