TkA03G570360 | RubberDandelionOmics

Gene overview

TkA03G570360

Reference: TK1151 Chr: Chr03 Coordinates: 144700823-144701224 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

402 bp · TkA03G570360|TK1151|cDNA

ATGTCAAATATCATAGTATCCTTTCTCACAATTTTAAAATGGACTCTTCATTTCTTAATCAACCATCTATTTTTCCACCATCGCATGATCCACCTGCAAGAAACCTACGAAGGGCATGGAATCAAGTGGTTCAATTGCAGAAAACAAGCTTCTTATGATGAAGAGGTAGTGTGTGCAGTGTGCTTGAACAAAATCGAGGAAGATGATGAGACTAGAGAGTTGAGATGCGATCACCAATTTCACAAAAATTGCTTGGATGG...

CDS

Download CDS FASTA

402 bp · TkA03G570360|TK1151|CDS

ATGTCAAATATCATAGTATCCTTTCTCACAATTTTAAAATGGACTCTTCATTTCTTAATCAACCATCTATTTTTCCACCATCGCATGATCCACCTGCAAGAAACCTACGAAGGGCATGGAATCAAGTGGTTCAATTGCAGAAAACAAGCTTCTTATGATGAAGAGGTAGTGTGTGCAGTGTGCTTGAACAAAATCGAGGAAGATGATGAGACTAGAGAGTTGAGATGCGATCACCAATTTCACAAAAATTGCTTGGATGG...

Protein

Download Protein FASTA

133 aa · TkA03G570360|TK1151|PROTEIN

MSNIIVSFLTILKWTLHFLINHLFFHHRMIHLQETYEGHGIKWFNCRKQASYDEEVVCAVCLNKIEEDDETRELRCDHQFHKNCLDGWLAHRHTTCPVCREHLVLPPKTNIYSCIIHSRGVYYDYSFRNIVIC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G570360`
TK1151 ID	TkA03G570360
OH-1004 ID	LXL04_011174
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	50.400
Protein coverage (%)	TK1151 93.985 / OH-1004 88.971 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G570360`
Location	Chr03:144700823-144701224 (-)
Description	Similar to XERICO: Probable E3 ubiquitin-protein ligase XERICO
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011174` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009651 response to salt stress Biological Process GO:0009687 abscisic acid metabolic process Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009739 response to gibberellin Biological Process GO:0016567 protein ubiquitination Biological Process GO:0042742 defense response to bacterium Biological Process GO:0098542 defense response to other organism Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT1G63170 ath:AT1G72220 ath:AT2G04240 ath:AT3G05200 ath:AT4G40070 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.293

Rank 1 · TkA03G570360 · TK1151

Endoplasmic reticulum0.260

Rank 2 · TkA03G570360 · TK1151

Nucleus0.241

Rank 3 · TkA03G570360 · TK1151

Lysosome / Vacuole0.166

Rank 4 · TkA03G570360 · TK1151

Cell membrane0.158

Rank 5 · TkA03G570360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12861zf-ANAPC1121-35 aa

PF23555zf-RING_Vps4135-47 aa

PF13920zf-C3HC4_345-66 aa

PF18912DZR_246-68 aa

PF20076DUF647250-75 aa

PF23413zf_RING_Vps8_fungal53-61 aa

PF29452FAR1_N53-69 aa

PF13920zf-C3HC4_355-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G570360	`PF12861`	zf-ANAPC11	21	35	0.01	16.6
TkA03G570360	`PF23555`	zf-RING_Vps41	35	47	0.34	11.2
TkA03G570360	`PF13920`	zf-C3HC4_3	45	66	0.016	15.7
TkA03G570360	`PF18912`	DZR_2	46	68	1.9	9.1
TkA03G570360	`PF20076`	DUF6472	50	75	5.3	8.0
TkA03G570360	`PF23413`	zf_RING_Vps8_fungal	53	61	0.013	15.5
TkA03G570360	`PF29452`	FAR1_N	53	69	1.4	9.7
TkA03G570360	`PF13920`	zf-C3HC4_3	55	102	0.016	15.7
TkA03G570360	`PF11793`	FANCL_C	56	94	0.15	13.1
TkA03G570360	`PF15227`	zf-C3HC4_4	56	76	0.23	12.3
TkA03G570360	`PF16685`	zf-RING_10	57	102	0.12	13.2
TkA03G570360	`PF24921`	RING_XB3-XBAT31	57	103	0.25	12.1
TkA03G570360	`PF29452`	FAR1_N	57	101	1.4	9.7
TkA03G570360	`PF08271`	Zn_Ribbon_TF	57	76	4.0	7.8
TkA03G570360	`PF13639`	zf-RING_2	58	100	6e-13	49.5
TkA03G570360	`PF00097`	zf-C3HC4	58	99	4.2e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card