Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2428 bp · TkA03G569210|TK1151|cDNA
CCCAAGTTGACCATTTTTATTTTTAGGAATAAACCATTTCACGGGTTCGTAAGGCGCACGTTAACATTACAAGCGAATTTGCTCTCTCGATTAAATGGCGGAGATCCCTTTTGCTCGATTAACGTAAAACAGCATATGATATTGAGTTGATTGGGAGGTGTAATTTCTCAATCTTTTTTGAGAAATCAACCCGACCCGACCTCGGTTCTGAATTCTGCAGATTGAGAAAACAGAACAAGAATGGATTCAATTTCAACTTA...
1788 bp · TkA03G569210|TK1151|CDS
ATGGATTCAATTTCAACTTATAACAGCAACGTTATTAATCCAGAGCTGGTGCGCTTTCACGAGGGTACCACTTCGGATTCCAAAGATATGGGAGAGATCGGAATCTCCATGGAAATTCTAACTAAAGTAGACCTCCAGTTGGCATACGCATCAGAGAAATTACTAAATTTGGAAAGTCTTTTGTTATACGTATTATCATGGGAAAACGACTTTGAAGCCATAGATTCTGACGATGTCTCAGTGGAATTCGTTGAAAAATC...
Protein
Download Protein FASTA595 aa · TkA03G569210|TK1151|PROTEIN
MDSISTYNSNVINPELVRFHEGTTSDSKDMGEIGISMEILTKVDLQLAYASEKLLNLESLLLYVLSWENDFEAIDSDDVSVEFVEKSLTVDLLFSFVDSEVKELDRSMDSIRVDLLDAHRRVSSCKHLGELYTVVEGKLNDSGDSLKQSQEHVLEMKMKLAKLQMTSFAFDHNECFSEDFQVSDLDSKPKLQTIDKVHVLRMLEKSLSRELDLEKKLTESKQNEEDLKLKLRLTEQVAFIMEEAAEVVWGRFLEAENSSV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G569210 |
|---|---|
| TK1151 ID | TkA03G569210 |
| OH-1004 ID | LXL04_011153 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 94.300 |
| Protein coverage (%) | TK1151 99.496 / OH-1004 79.617Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G569210 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:144364142-144367687 (+) | |||||||||
| Description | Similar to WIT2: WPP domain-interacting tail-anchored protein 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000132 establishment of mitotic spindle orientation Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0007017 microtubule-based process Biological Process GO:0007077 mitotic nuclear membrane disassembly Biological Process GO:0007097 nuclear migration Biological Process GO:0007528 neuromuscular junction development Biological Process GO:0010457 centriole-centriole cohesion Biological Process GO:0031116 positive regulation of microtubule polymerization Biological Process GO:0031122 cytoplasmic microtubule organization Biological Process GO:0032402 melanosome transport Biological Process GO:0034454 microtubule anchoring at centrosome Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G68910 ath:AT5G11390 hsa:1639 rno:29167 ssc:100519249 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26581WIT1_2_N35-170 aaPF05377FlaC_arch98-135 aaPF23991DUF731098-112 aaPF05739SNARE99-123 aaPF08614ATG16100-164 aaPF07544Med9100-128 aaPF23649FKBP15124-162 aaPF00261Tropomyosin133-133 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G569210 | PF26581 | WIT1_2_N | 35 | 170 | 2.1e-46 | 157.9 |
| TkA03G569210 | PF05377 | FlaC_arch | 98 | 135 | 0.039 | 15.1 |
| TkA03G569210 | PF23991 | DUF7310 | 98 | 112 | 5.4 | 8.3 |
| TkA03G569210 | PF05739 | SNARE | 99 | 123 | 0.42 | 11.2 |
| TkA03G569210 | PF08614 | ATG16 | 100 | 164 | 0.021 | 15.7 |
| TkA03G569210 | PF07544 | Med9 | 100 | 128 | 0.35 | 11.7 |
| TkA03G569210 | PF23649 | FKBP15 | 124 | 162 | 3e-05 | 24.4 |
| TkA03G569210 | PF00261 | Tropomyosin | 133 | 133 | 0.0011 | 19.2 |
| TkA03G569210 | PF10779 | XhlA | 135 | 159 | 0.023 | 15.6 |
| TkA03G569210 | PF30677 | CCDC18_1st | 139 | 164 | 0.0034 | 17.4 |
| TkA03G569210 | PF05557 | MAD | 148 | 229 | 0.0016 | 17.6 |
| TkA03G569210 | PF24627 | PUMA_CC | 152 | 168 | 0.0012 | 19.5 |
| TkA03G569210 | PF23649 | FKBP15 | 195 | 237 | 3e-05 | 24.4 |
| TkA03G569210 | PF30677 | CCDC18_1st | 198 | 237 | 0.0034 | 17.4 |
| TkA03G569210 | PF05266 | DUF724 | 199 | 247 | 0.0098 | 16.5 |
| TkA03G569210 | PF19220 | Rod_CreS | 200 | 222 | 1.9e-05 | 24.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.