TkA03G557080 | RubberDandelionOmics

Gene overview

TkA03G557080

Reference: TK1151 Chr: Chr03 Coordinates: 140999021-141001376 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

747 bp · TkA03G557080|TK1151|cDNA

ATGATATTTGTAAGGATACCGATAGACGAGATGGTGAGGCACGTGCCACTGGTGTGTAAGTCGTGGATGGCGGCGGTAGCAGAGCCGTATTGCTGGCATGACATCGATGTGGTAGATTGGTGTCAACGACACTATGATATTAATGCAATTGACCAAGCGGTCATGAAGCTTGTACGTTTGAGCAAGCGTACATTTCAACGTCTCTCCGTCTATCGGTTGGGAAACACTGGCTTCGGCTTCATCGCCAACCGCGCAAGGTG...

CDS

Download CDS FASTA

747 bp · TkA03G557080|TK1151|CDS

ATGATATTTGTAAGGATACCGATAGACGAGATGGTGAGGCACGTGCCACTGGTGTGTAAGTCGTGGATGGCGGCGGTAGCAGAGCCGTATTGCTGGCATGACATCGATGTGGTAGATTGGTGTCAACGACACTATGATATTAATGCAATTGACCAAGCGGTCATGAAGCTTGTACGTTTGAGCAAGCGTACATTTCAACGTCTCTCCGTCTATCGGTTGGGAAACACTGGCTTCGGCTTCATCGCCAACCGCGCAAGGTG...

Protein

Download Protein FASTA

248 aa · TkA03G557080|TK1151|PROTEIN

MIFVRIPIDEMVRHVPLVCKSWMAAVAEPYCWHDIDVVDWCQRHYDINAIDQAVMKLVRLSKRTFQRLSVYRLGNTGFGFIANRARCLKTLEIPMSEVTDDMVLKHVKSLRNLTVLDISDCSKITVIGLEAFGNQCKSLVSLKRNMFVQRNWDSFEEPFAMVDDSEANIIANSMPNLQNLELGYGLLGDYGLFEILTKCKSLTRLDIQGSSNAMLNGGFEESLQRLEYFRSPHINYSDEFYESGADSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G557080`
TK1151 ID	TkA03G557080
OH-1004 ID	LXL04_031161
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	33.200
Protein coverage (%)	TK1151 94.355 / OH-1004 73.548 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G557080`
Location	Chr03:140999021-141001376 (-)
Description	Similar to FBW2: F-box protein FBW2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031161` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010608 post-transcriptional regulation of gene expression Biological Process GO:0010629 negative regulation of gene expression Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0019005 SCF ubiquitin ligase complex Cellular Component GO:1905761 SCF ubiquitin ligase complex binding Molecular Function
KEGG gene cross-reference	ath:AT4G05460 ath:AT4G05497 ath:AT4G08980 ath:AT5G57900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.568

Rank 1 · TkA03G557080 · TK1151

Cytoplasm0.331

Rank 2 · TkA03G557080 · TK1151

Plastid0.079

Rank 3 · TkA03G557080 · TK1151

Cell membrane0.052

Rank 4 · TkA03G557080 · TK1151

Mitochondrion0.042

Rank 5 · TkA03G557080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like2-36 aa

PF25013LRR_Zer-145-63 aa

PF13855LRR_857-68 aa

PF29594LRR_SKP280-216 aa

PF23247LRR_RPS283-127 aa

PF25372LRR_FBXL1586-210 aa

PF13516LRR_686-100 aa

PF24758LRR_At5g5637087-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G557080	`PF12937`	F-box-like	2	36	0.006	17.0
TkA03G557080	`PF25013`	LRR_Zer-1	45	63	0.058	14.2
TkA03G557080	`PF13855`	LRR_8	57	68	0.0025	18.3
TkA03G557080	`PF29594`	LRR_SKP2	80	216	0.00019	21.5
TkA03G557080	`PF23247`	LRR_RPS2	83	127	0.21	12.2
TkA03G557080	`PF25372`	LRR_FBXL15	86	210	7.2e-07	28.7
TkA03G557080	`PF13516`	LRR_6	86	100	0.00021	21.8
TkA03G557080	`PF24758`	LRR_At5g56370	87	142	0.048	14.0
TkA03G557080	`PF23952`	LRR_EndoS	89	212	0.036	15.0
TkA03G557080	`PF25013`	LRR_Zer-1	106	122	0.058	14.2
TkA03G557080	`PF13516`	LRR_6	111	132	0.00021	21.8
TkA03G557080	`PF13855`	LRR_8	111	142	0.0025	18.3
TkA03G557080	`PF12799`	LRR_4	112	142	1.4e-05	25.9
TkA03G557080	`PF00560`	LRR_1	112	134	0.26	12.3
TkA03G557080	`PF24758`	LRR_At5g56370	171	213	0.048	14.0
TkA03G557080	`PF12799`	LRR_4	172	184	1.4e-05	25.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card