TkA03G556410 | RubberDandelionOmics

Gene overview

TkA03G556410

Reference: TK1151 Chr: Chr03 Coordinates: 140856972-140860348 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

1095 bp · TkA03G556410|TK1151|CDS

AAAAAAGTCATAAAATTGGGAACCGCTAAATTCCCCTGTTTTACACCCTTTCCCTTCCGATACTGCCTTCGAAGGTTTCTCTCATTCCGAATCTATCTCCTATCTAGTTTCATCCCGGCAGCTTATATGGACGTCGGCGGTGTCTTGTTGGAGAACGGCAATCGCGAGAAGCCTCATTCAGCATTGATCTTTTTAGGGACTGGTTGCTCGAGTGCCGTTCCCAACGCATTGTGCCTGATCCAGCCATCTGATCCTCCGTG...

Protein

Download Protein FASTA

364 aa · TkA03G556410|TK1151|PROTEIN

KKVIKLGTAKFPCFTPFPFRYCLRRFLSFRIYLLSSFIPAAYMDVGGVLLENGNREKPHSALIFLGTGCSSAVPNALCLIQPSDPPCKVCIQSLSTPPERNPNYRCNTSLLIDYSPSAGEHKYILIDVGKTFREQVLRWFTFHKIPQVDSIILTHEHADAVLGLDDIRAVQPFSPTNDIEPTPIFLNQHAMDSLQVKFPYLVQKKLKAGQEVRRVTQLDWQIIENDSKRPFVASGLEITPLPVMHGEDYICLGFSFGKST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G556410`
TK1151 ID	TkA03G556410
OH-1004 ID	LXL04_017003
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 88.462 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G556410`
Location	Chr03:140856972-140860348 (-)
Description	Similar to SPCC777.06c: Putative hydrolase C777.06c (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017003` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009249 protein lipoylation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016787 hydrolase activity Molecular Function GO:0033819 lipoyl(octanoyl) transferase activity Molecular Function
KEGG gene cross-reference	pgi:PG_1343 spo:2538874 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.314

Rank 1 · TkA03G556410 · TK1151

Cytoplasm0.273

Rank 2 · TkA03G556410 · TK1151

Nucleus0.170

Rank 3 · TkA03G556410 · TK1151

Endoplasmic reticulum0.127

Rank 4 · TkA03G556410 · TK1151

Peroxisome0.083

Rank 5 · TkA03G556410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00753Lactamase_B113-195 aa

PF23023Anti-Pycsar_Apyc1120-311 aa

PF12706Lactamase_B_2123-326 aa

PF12706Lactamase_B_2330-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G556410	`PF00753`	Lactamase_B	113	195	0.00034	21.3
TkA03G556410	`PF23023`	Anti-Pycsar_Apyc1	120	311	1.2e-08	35.8
TkA03G556410	`PF12706`	Lactamase_B_2	123	326	3.6e-25	89.4
TkA03G556410	`PF12706`	Lactamase_B_2	330	357	3.6e-25	89.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card