RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G551540
Reference: TK1151 Chr: Chr03 Coordinates: 139655251-139660738 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3976 bp · TkA03G551540|TK1151|cDNA

GAAAGAGACACCGTCGATTATTATCCAACAACTTTTTTTCCTTCCAAATATTATATTGTTTTATTTAAAACGGATCAAATTTTATGTTTTCATTATATTTCAGTAGAATATTAATTTAGTAAAAGATATGTTGTTTTCTCGTCGTTAGCGATTTCTACATCGCCATTAACAGCTGGAACATCTTGCAGACAGTCTCTCTGCATCTATATAAATATTTATGTTTAGATACTCAGCAGTCGGCCCTTGTGCTTCTCAATTAC...

CDS

Download CDS FASTA

3249 bp · TkA03G551540|TK1151|CDS

ATGGAATCGGAAGGAGAGACGGGGGGGACGTCTATGAAGAATGTCGGTGGTCAGGTTTGCCAGATCTGTGGTGATAAGGTTGGCACCACAGCTAAAGGAGACGCTTTTGTTGCCTGTGATGTCTGCGGATTCCCAGTTTGCAGGCCCTGCTATGAATACGAACGCAAGGATGGCAATCAATCATGCCCTCAATGCAAAACCAGATACAAACGACTCAAAGGAAGCCCTGCTATTCCTGGGGACAAAGAGGAGGATGTTGA...

Protein

Download Protein FASTA

1082 aa · TkA03G551540|TK1151|PROTEIN

MESEGETGGTSMKNVGGQVCQICGDKVGTTAKGDAFVACDVCGFPVCRPCYEYERKDGNQSCPQCKTRYKRLKGSPAIPGDKEEDVDTDEETTNFPFSSQTQSEKQKTAERMLSWHMTYGRGEETNTPNYDKEVSHNHIPLLTSGQEVSGELSAASPQRLSVSSPPPGGERLTHSLPYSAYVNQSPNVRVVDPVRDYGSTGLGNVAWKERVDGWKMKQDKNVVPMATSRPASERGQDIDANTDVLVDDSLLNDEARQPLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G551540
TK1151 IDTkA03G551540
OH-1004 IDLXL04_010844
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G551540
LocationChr03:139655251-139660738 (+)
DescriptionSimilar to CESA3: Cellulose synthase A catalytic subunit 3 [UDP-forming]
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g05170 Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation.
The Arabidopsis mutant cev1 has constitutively active jasmonate and ethylene signal pathways and enhanced resistance to pathogens.2001 · DOI: 10.1105/tpc.13.5.1025
Functional analysis of the cellulose synthase genes CesA1, CesA2, and CesA3 in Arabidopsis.2002 · DOI: 10.1104/pp.010931
The Arabidopsis mutant cev1 links cell wall signaling to jasmonate and ethylene responses.2002 · DOI: 10.1105/tpc.002022
Reduced cellulose synthesis invokes lignification and defense responses in Arabidopsis thaliana.2003 · DOI: 10.1046/j.1365-313x.2003.01729.x
Genetic evidence for three unique components in primary cell-wall cellulose synthase complexes in Arabidopsis.2007 · DOI: 10.1073/pnas.0706592104
Organization of cellulose synthase complexes involved in primary cell wall synthesis in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0706569104

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0208500 Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. No verified direct reference in this release
UniProt: A2XN66 Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. No verified direct reference in this release
Os03g0808100 Probable catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. No verified direct reference in this release
UniProt: A2Y0X2 Catalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009833 plant-type primary cell wall biogenesis Biological Process
GO:0009834 plant-type secondary cell wall biogenesis Biological Process
GO:0030244 cellulose biosynthetic process Biological Process
GO:0071555 cell wall organization Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005768 endosome Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005802 trans-Golgi network Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT5G05170
dosa:Os03g0808100
dosa:Os05g0176100
dosa:Os07g0208500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.506
Rank 1 · TkA03G551540 · TK1151
Endoplasmic reticulum0.212
Rank 2 · TkA03G551540 · TK1151
Golgi apparatus0.210
Rank 3 · TkA03G551540 · TK1151
Cytoplasm0.165
Rank 4 · TkA03G551540 · TK1151
Lysosome / Vacuole0.102
Rank 5 · TkA03G551540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14569zf-UDP11-85 aa
PF02318FYVE_213-68 aa
PF14446Prok-RING_117-56 aa
PF13920zf-C3HC4_318-70 aa
PF22586ANCHR-like_BBOX19-58 aa
PF13639zf-RING_219-66 aa
PF14570zf-RING_420-70 aa
PF05290Baculo_IE-120-71 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G551540PF14569zf-UDP11851.9e-39134.3
TkA03G551540PF02318FYVE_213680.1313.1
TkA03G551540PF14446Prok-RING_117560.1612.8
TkA03G551540PF13920zf-C3HC4_318701.69.3
TkA03G551540PF22586ANCHR-like_BBOX19580.07313.9
TkA03G551540PF13639zf-RING_219667.67.6
TkA03G551540PF14570zf-RING_420701.1e-0525.8
TkA03G551540PF05290Baculo_IE-120710.2512.0
TkA03G551540PF00097zf-C3HC420651.39.7
TkA03G551540PF14634zf-RING_520674.58.0
TkA03G551540PF00628PHD20657.07.5
TkA03G551540PF10601zf-LITAF-like35681.69.7
TkA03G551540PF14446Prok-RING_162710.1612.8
TkA03G551540PF03552Cellulose_synt35310761380.8
TkA03G551540PF13641Glyco_tranf_2_33673920.1112.9
TkA03G551540PF13632Glyco_trans_2_37568761.4e-0732.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q941L0Arabidopsis thalianasp|Q941L0|CESA3_ARATH Cellulose synthase A catalytic subunit 3 [UDP-forming]82.700%Swiss-ProtHigh
Q84ZN6Oryza sativa subsp. japonicasp|Q84ZN6|CESA8_ORYSJ Probable cellulose synthase A catalytic subunit 8 [UDP-forming]80.200%Swiss-ProtHigh
A2XN66Oryza sativa subsp. indicasp|A2XN66|CESA2_ORYSI Probable cellulose synthase A catalytic subunit 2 [UDP-forming]79.300%Swiss-ProtHigh
Q84M43Oryza sativa subsp. japonicasp|Q84M43|CESA2_ORYSJ Probable cellulose synthase A catalytic subunit 2 [UDP-forming]79.300%Swiss-ProtHigh
A2Y0X2Oryza sativa subsp. indicasp|A2Y0X2|CESA1_ORYSI Probable cellulose synthase A catalytic subunit 1 [UDP-forming]70.000%Swiss-ProtHigh

JBrowse

View in Genome Browser