TkA03G550040 | RubberDandelionOmics

Gene overview

TkA03G550040

Reference: TK1151 Chr: Chr03 Coordinates: 139234348-139235545 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

717 bp · TkA03G550040|TK1151|cDNA

TCGCAAACAAAAAGGCATAAGAAAAAAAGTTTAGGAGCAAACCCACGGTTTTTATGCCTTTCTCAATTGCCATCCCATTGTCGTCGACGCCACTTCCGCCACCATACCACGCCGCCGCGGCCTCTCTTTGATTAAACCGGCAATACACTACGATACAGAGCATTAGCTACAAAGGGGCTATAGAGATGGAATTCTGCCCAACTTGTGGGATGTTGTTGAAGTACGAGTTACCAAACATGAGTCTTCCTGCAAGATTTTTC...

CDS

Download CDS FASTA

333 bp · TkA03G550040|TK1151|CDS

ATGGAATTCTGCCCAACTTGTGGGATGTTGTTGAAGTACGAGTTACCAAACATGAGTCTTCCTGCAAGATTTTTCTGTCCTACATGTCCATATGTTAGTCAAATTGAGCAGAAGAGGTCAAGATCAAAGAAAGCAACGTTTGGTGAAAAAGAGATTGATCCCATCATCACCAAAGATGACATGAGCAATGCGCCAAAAACAGATCAAGCTCATTGTCCAAATTGTGGTCACAATAAGGCTGCATACATTCAGTTTCAAAC...

Protein

Download Protein FASTA

110 aa · TkA03G550040|TK1151|PROTEIN

MEFCPTCGMLLKYELPNMSLPARFFCPTCPYVSQIEQKRSRSKKATFGEKEIDPIITKDDMSNAPKTDQAHCPNCGHNKAAYIQFQTRSADEPMTINFTCEKCNHCWRED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G550040`
TK1151 ID	TkA03G550040
OH-1004 ID	LXL04_012123
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	49.000
Protein coverage (%)	TK1151 44.545 / OH-1004 14.826 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G550040`
Location	Chr03:139234348-139235545 (-)
Description	Similar to TFIIS: Transcription elongation factor TFIIS
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012123` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006354 DNA-templated transcription elongation Biological Process GO:0006368 transcription elongation by RNA polymerase II Biological Process GO:0009408 response to heat Biological Process GO:0009739 response to gibberellin Biological Process GO:0009845 seed germination Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0010162 seed dormancy process Biological Process GO:0032784 regulation of DNA-templated transcription elongation Biological Process GO:0034243 regulation of transcription elongation by RNA polymerase II Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT2G38560 bta:505722 bta:507729 hsa:6919 mmu:21399 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.536

Rank 1 · TkA03G550040 · TK1151

Cytoplasm0.517

Rank 2 · TkA03G550040 · TK1151

Mitochondrion0.082

Rank 3 · TkA03G550040 · TK1151

Cell membrane0.042

Rank 4 · TkA03G550040 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA03G550040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02150Zn_ribbon_RPB91-37 aa

PF13248Zn_ribbon_32-11 aa

PF28086HVO_21422-31 aa

PF12773DZR2-37 aa

PF21349RUBY_RBDX2-9 aa

PF14803Zn_ribbon_Nudix3-32 aa

PF08271Zn_Ribbon_TF3-14 aa

PF11792Baculo_LEF5_C3-9 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G550040	`PF02150`	Zn_ribbon_RPB9	1	37	0.0081	16.7
TkA03G550040	`PF13248`	Zn_ribbon_3	2	11	0.034	14.3
TkA03G550040	`PF28086`	HVO_2142	2	31	0.071	13.6
TkA03G550040	`PF12773`	DZR	2	37	0.074	13.9
TkA03G550040	`PF21349`	RUBY_RBDX	2	9	0.56	10.4
TkA03G550040	`PF14803`	Zn_ribbon_Nudix	3	32	1.8e-05	25.2
TkA03G550040	`PF08271`	Zn_Ribbon_TF	3	14	0.0033	17.7
TkA03G550040	`PF11792`	Baculo_LEF5_C	3	9	0.0036	17.7
TkA03G550040	`PF06044`	DpnI	3	42	0.0071	16.7
TkA03G550040	`PF26408`	DUF8106	3	8	0.47	11.0
TkA03G550040	`PF25923`	DUF7969	3	13	0.8	10.7
TkA03G550040	`PF12677`	DUF3797	3	8	7.7	7.3
TkA03G550040	`PF01096`	Zn_ribbon_TFIIS	4	8	1.8e-17	63.5
TkA03G550040	`PF07282`	Cas12f1-like_TNB	4	32	0.01	16.7
TkA03G550040	`PF24042`	DUF7351	4	107	0.01	16.3
TkA03G550040	`PF28055`	VVA0879	4	10	0.098	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card