TkA03G550010 | RubberDandelionOmics

Gene overview

TkA03G550010

Reference: TK1151 Chr: Chr03 Coordinates: 139223540-139224074 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

535 bp · TkA03G550010|TK1151|cDNA

AGAGAAGTGGAGGCAGGGCAATTGAATGTTGTAGCATTGTATATGCATCATGGAAAGAGTGGGATTATGGAAGAAGAGGTTGTAAATGAGATAAAGATTTTGGCTGAAAATCAGAGGAGAGAAATGATGAAGTTAGTTCTGGAAACTAAAGGAAGCATTGTTCCAAGAGCTTGCAAAGATGCATTTTGGAATACATGTAACGTGGTGAATCTTTTTTATGCAACAGACGACGGGTGGACCGGAAATGCCATACATGATAC...

CDS

Download CDS FASTA

324 bp · TkA03G550010|TK1151|CDS

AGAGAAGTGGAGGCAGGGCAATTGAATGTTGTAGCATTGTATATGCATCATGGAAAGAGTGGGATTATGGAAGAAGAGGTTGTAAATGAGATAAAGATTTTGGCTGAAAATCAGAGGAGAGAAATGATGAAGTTAGTTCTGGAAACTAAAGGAAGCATTGTTCCAAGAGCTTGCAAAGATGCATTTTGGAATACATGTAACGTGGTGAATCTTTTTTATGCAACAGACGACGGGTGGACCGGAAATGCCATACATGATAC...

Protein

Download Protein FASTA

107 aa · TkA03G550010|TK1151|PROTEIN

REVEAGQLNVVALYMHHGKSGIMEEEVVNEIKILAENQRREMMKLVLETKGSIVPRACKDAFWNTCNVVNLFYATDDGWTGNAIHDTVDKIIYKSVSHESVLNKTCN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G550010`
TK1151 ID	TkA03G550010
OH-1004 ID	LXL04_010816
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 13.896 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G550010

Location Chr03:139223540-139224074 (+)

Description Similar to KS: Ent-kaur-16-ene synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79460`	Involved in the biosynthesis of ent-kaurene diterpenoids natural products and in the production of gibberellins phytohormones.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010816 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0033331 ent-kaurene metabolic process Biological Process

GO:0033332 ent-kaurene biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0009899 ent-kaurene synthase activity Molecular Function

GO:0102161 copal-8-ol diphosphate synthase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.618

Rank 1 · TkA03G550010 · TK1151

Plastid0.246

Rank 2 · TkA03G550010 · TK1151

Nucleus0.201

Rank 3 · TkA03G550010 · TK1151

Cell membrane0.081

Rank 4 · TkA03G550010 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA03G550010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAK2`	Arabidopsis thaliana	sp\|Q9SAK2\|KSB_ARATH Ent-kaur-16-ene synthase, chloroplastic	47.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card