TkA03G549300 | RubberDandelionOmics

Gene overview

TkA03G549300

Reference: TK1151 Chr: Chr03 Coordinates: 138973878-138974946 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA03G549300|TK1151|cDNA

ATGATGCACCCAATTGACACTGTGAAAACTCGAATCCAAAGTCAAGCCATCTTGACTCAATCCCAGGAAACAAAGAGTATATTACAGATGGTGAAAGCTGTCTGGGGTGCTGATGGCTTAAGAGGGTTTTACAGAGGTGTTGCACCTGGATTAACTGGATCACTTGTAACTGGTGCAACATATTTTGGTGTAATAGAATCAACAAAAAAATGGATGGAAGAAACTCACCCAAATCTTGGAGGTCACTGGGCCCACTTCAT...

CDS

Download CDS FASTA

579 bp · TkA03G549300|TK1151|CDS

ATGATGCACCCAATTGACACTGTGAAAACTCGAATCCAAAGTCAAGCCATCTTGACTCAATCCCAGGAAACAAAGAGTATATTACAGATGGTGAAAGCTGTCTGGGGTGCTGATGGCTTAAGAGGGTTTTACAGAGGTGTTGCACCTGGATTAACTGGATCACTTGTAACTGGTGCAACATATTTTGGTGTAATAGAATCAACAAAAAAATGGATGGAAGAAACTCACCCAAATCTTGGAGGTCACTGGGCCCACTTCAT...

Protein

Download Protein FASTA

192 aa · TkA03G549300|TK1151|PROTEIN

MMHPIDTVKTRIQSQAILTQSQETKSILQMVKAVWGADGLRGFYRGVAPGLTGSLVTGATYFGVIESTKKWMEETHPNLGGHWAHFIAGALGDTLGSFIYVPCEVIKQRMQVQGTRKYWTSVVMKDAALDSTMYAYYSGMFQAGCSIWKDQGPKGLYTGYWSTLVRDVPFAGLMVTCYEALNHGGYYYSVFF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G549300`
TK1151 ID	TkA03G549300
OH-1004 ID	LXL04_031464
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 95.833 / OH-1004 54.354 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G549300`
Location	Chr03:138973878-138974946 (+)
Description	Similar to SAMC1: S-adenosylmethionine carrier 1, chloroplastic/mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031464` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009658 chloroplast organization Biological Process GO:0015693 magnesium ion transport Biological Process GO:0015805 S-adenosyl-L-methionine transport Biological Process GO:0048250 iron import into the mitochondrion Biological Process GO:1990616 magnesium ion export from mitochondrion Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0031966 mitochondrial membrane Cellular Component
KEGG gene cross-reference	ath:AT1G34065 ath:AT4G39460 ddi:DDB_G0269394 ddi:DDB_G0269470 sce:YMR166C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.912

Rank 1 · TkA03G549300 · TK1151

Cytoplasm0.036

Rank 2 · TkA03G549300 · TK1151

Nucleus0.024

Rank 3 · TkA03G549300 · TK1151

Plastid0.020

Rank 4 · TkA03G549300 · TK1151

Cell membrane0.018

Rank 5 · TkA03G549300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00153Mito_carr2-74 aa

PF00153Mito_carr83-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G549300	`PF00153`	Mito_carr	2	74	1.6e-36	124.6
TkA03G549300	`PF00153`	Mito_carr	83	182	1.6e-36	124.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card