TkA03G543180 | RubberDandelionOmics

Gene overview

TkA03G543180

Reference: TK1151 Chr: Chr03 Coordinates: 136954744-136957886 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1709 bp · TkA03G543180|TK1151|cDNA

AAAAAGGCGAAATTTAGTTGCCTTGTAGAAATCAGTCTACTCACAGAGTTCTCAAGGGGGGCAACAGGCGACTGAAAGCTTCGAGTCGAAATCCGTGGAACGAAACCCTACGAAGCGGTGTGATTATGGAGACCGAGGAAGAAGCATCTGGACAGATGACGGACGAGATCTACACCAACGGCGGCGAAGATGAACCGTTGCAGCAGCAGCAGCAACGGAGACCGATTATCAGTGGCGAGCAACTCGACATCGAGGCGTAC...

CDS

Download CDS FASTA

1341 bp · TkA03G543180|TK1151|CDS

ATGGAGACCGAGGAAGAAGCATCTGGACAGATGACGGACGAGATCTACACCAACGGCGGCGAAGATGAACCGTTGCAGCAGCAGCAGCAACGGAGACCGATTATCAGTGGCGAGCAACTCGACATCGAGGCGTACGCCGCCTTATACACAGGTCGTACTAAAATTTCGCGGTTGATATTCATCGCCGACAAATGTGGTAATGTTTCGATGCAGTTAGAGGCGCTTCGAATGGCGTATGATGAGATTAAGAAGGGAGAGAA...

Protein

Download Protein FASTA

446 aa · TkA03G543180|TK1151|PROTEIN

METEEEASGQMTDEIYTNGGEDEPLQQQQQRRPIISGEQLDIEAYAALYTGRTKISRLIFIADKCGNVSMQLEALRMAYDEIKKGENTQLFREVVHKIDGRLGPNYSADSSWMDAVDRRADQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYSHGALGDAFKNYVRTRDYCTTAKHIIHMCLNAILVSIEMGQFAHVTSYVSKAEQNKNDLDPITISKLQCAAGLAHLEAKKYKHAARKFLETAPELGNNYSEVIAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G543180`
TK1151 ID	TkA03G543180
OH-1004 ID	LXL04_010682
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G543180

Location Chr03:136954744-136957886 (+)

Description Similar to CSN1: COP9 signalosome complex subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61140`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	The COP9 complex, a novel multisubunit nuclear regulator involved in light control of a plant developmental switch.1996 · DOI: 10.1016/s0092-8674(00)80082-3

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010682 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007254 JNK cascade Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0045116 protein neddylation Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:2000434 regulation of protein neddylation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G61140

ddi:DDB_G0283587

hsa:2873

xla:431842

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.613

Rank 1 · TkA03G543180 · TK1151

Cytoplasm0.466

Rank 2 · TkA03G543180 · TK1151

Lysosome / Vacuole0.065

Rank 3 · TkA03G543180 · TK1151

Cell membrane0.055

Rank 4 · TkA03G543180 · TK1151

Golgi apparatus0.040

Rank 5 · TkA03G543180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10602RPN7109-283 aa

PF01399PCI129-145 aa

PF18181SLATT_1197-258 aa

PF01399PCI322-401 aa

PF18181SLATT_1342-370 aa

PF10602RPN7368-395 aa

PF21151CSN1_C405-431 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G543180	`PF10602`	RPN7	109	283	1.8e-55	188.0
TkA03G543180	`PF01399`	PCI	129	145	2.8e-16	60.2
TkA03G543180	`PF18181`	SLATT_1	197	258	0.017	15.9
TkA03G543180	`PF01399`	PCI	322	401	2.8e-16	60.2
TkA03G543180	`PF18181`	SLATT_1	342	370	0.017	15.9
TkA03G543180	`PF10602`	RPN7	368	395	1.8e-55	188.0
TkA03G543180	`PF21151`	CSN1_C	405	431	1e-08	35.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P45432`	Arabidopsis thaliana	sp\|P45432\|CSN1_ARATH COP9 signalosome complex subunit 1	76.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card