TkA03G538090 | RubberDandelionOmics

Gene overview

TkA03G538090

Reference: TK1151 Chr: Chr03 Coordinates: 135469600-135475859 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1792 bp · TkA03G538090|TK1151|cDNA

CTTCTTTCCCTCACCACTCCATATTCAGCCATTTTCTTCTTGCTTGTTGGCTAAGAGGATTTGAATCCTACTATTTTTAGAAGTTTGCTGTGCTCAAATTGTTCCTGCTTTCTCCAAATCGTGATTCCTCATATAGATGGATGGCGGAATCAAAACAAAGCTTATTCAACACAAAGAAGAAGAAGAACAAGAAAAAGACCAAGACTTTAAACAAAGGATATGGGTCGAATCAAAAAAGATATGGAGGGTCGCCTTGCCTG...

CDS

Download CDS FASTA

1476 bp · TkA03G538090|TK1151|CDS

ATGGATGGCGGAATCAAAACAAAGCTTATTCAACACAAAGAAGAAGAAGAACAAGAAAAAGACCAAGACTTTAAACAAAGGATATGGGTCGAATCAAAAAAGATATGGAGGGTCGCCTTGCCTGGTATCATAGCACGGGTTTGCGCGTTTGGAACTCTTGTTGTCACCCAGTCATTCATGGGACATATTGGTGAAACAGATCTTGCAGGCTATGCACTTGTTCAAACACTTAGTGTTCGGTTTGTCAATGGAATAATTTT...

Protein

Download Protein FASTA

491 aa · TkA03G538090|TK1151|PROTEIN

MDGGIKTKLIQHKEEEEQEKDQDFKQRIWVESKKIWRVALPGIIARVCAFGTLVVTQSFMGHIGETDLAGYALVQTLSVRFVNGIILGMSSATETLCGQAFGAGQDHMMGIYLQRSWIVDLITLTIMLPIFIFGTQIFLLVGEAESIATSGGYISLWFIPFVYNFVFSLTIQMYLQAQSKNMIIAWISVFQFTVHIPMSLLFVYKLNMGVSGAMIALSFSSWFLVIGEFIYIFGGWCPHSWKGFTVAAFKDLLPVVKLSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G538090`
TK1151 ID	TkA03G538090
OH-1004 ID	LXL04_026935
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.100
Protein coverage (%)	TK1151 98.778 / OH-1004 99.793 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G538090

Location Chr03:135469600-135475859 (+)

Description Similar to DTX24: Protein DETOXIFICATION 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03620`	Protein DETOXIFICATION 24.	No verified direct reference in this release
`At5g17700`	Protein DETOXIFICATION 25.	No verified direct reference in this release
`At1g33100`	Protein DETOXIFICATION 20.	No verified direct reference in this release
`At1g33110`	Protein DETOXIFICATION 21.	No verified direct reference in this release
`At1g33090`	Protein DETOXIFICATION 22.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026935 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0042910 xenobiotic transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G33090

ath:AT1G33100

ath:AT1G33110

ath:AT3G03620

ath:AT5G17700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.364

Rank 1 · TkA03G538090 · TK1151

Lysosome / Vacuole0.343

Rank 2 · TkA03G538090 · TK1151

Endoplasmic reticulum0.150

Rank 3 · TkA03G538090 · TK1151

Cytoplasm0.078

Rank 4 · TkA03G538090 · TK1151

Golgi apparatus0.077

Rank 5 · TkA03G538090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE43-199 aa

PF19628DUF613279-89 aa

PF28190MMSYN1_0478170-203 aa

PF01554MatE210-229 aa

PF01554MatE263-423 aa

PF19628DUF6132329-354 aa

PF28190MMSYN1_0478334-417 aa

PF19628DUF6132407-428 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G538090	`PF01554`	MatE	43	199	8.5e-42	143.3
TkA03G538090	`PF19628`	DUF6132	79	89	1.7	9.1
TkA03G538090	`PF28190`	MMSYN1_0478	170	203	0.0027	18.3
TkA03G538090	`PF01554`	MatE	210	229	8.5e-42	143.3
TkA03G538090	`PF01554`	MatE	263	423	8.5e-42	143.3
TkA03G538090	`PF19628`	DUF6132	329	354	1.7	9.1
TkA03G538090	`PF28190`	MMSYN1_0478	334	417	0.0027	18.3
TkA03G538090	`PF19628`	DUF6132	407	428	1.7	9.1
TkA03G538090	`PF01554`	MatE	434	452	8.5e-42	143.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J158`	Arabidopsis thaliana	sp\|F4J158\|DTX24_ARATH Protein DETOXIFICATION 24	52.400%	Swiss-Prot	High
`Q8L616`	Arabidopsis thaliana	sp\|Q8L616\|DTX25_ARATH Protein DETOXIFICATION 25	49.000%	Swiss-Prot	Medium
`F4HPH2`	Arabidopsis thaliana	sp\|F4HPH2\|DTX20_ARATH Protein DETOXIFICATION 20	48.200%	Swiss-Prot	Medium
`Q8W488`	Arabidopsis thaliana	sp\|Q8W488\|DTX21_ARATH Protein DETOXIFICATION 21	49.900%	Swiss-Prot	Medium
`F4HPH1`	Arabidopsis thaliana	sp\|F4HPH1\|DTX22_ARATH Protein DETOXIFICATION 22	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card