TkA03G537680 | RubberDandelionOmics

Gene overview

TkA03G537680

Reference: TK1151 Chr: Chr03 Coordinates: 135363523-135365052 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

558 bp · TkA03G537680|TK1151|cDNA

ATGGGTCATGTTCATCGCTTCGTAGGTCTGTCTGTTGGTCTTATTCAAGAACTTGGTTTTGATTATTTGAGAGACAATCTTGCTGGAAGCAGTGGACAACTTGTTATGAGATGGCGAAAACCATTCCATTTTGCAATAGTTGATGAAGTTGATTCAGTCCTAATTGATGATGGAAGAAACCCTTTGCTAATAAGTGGTGAGGCTAGCAAGGATGCAGCATGTTATCCAGTTGCTGCCAAAGTAGCCGAGCTTCTCATACG...

CDS

Download CDS FASTA

558 bp · TkA03G537680|TK1151|CDS

ATGGGTCATGTTCATCGCTTCGTAGGTCTGTCTGTTGGTCTTATTCAAGAACTTGGTTTTGATTATTTGAGAGACAATCTTGCTGGAAGCAGTGGACAACTTGTTATGAGATGGCGAAAACCATTCCATTTTGCAATAGTTGATGAAGTTGATTCAGTCCTAATTGATGATGGAAGAAACCCTTTGCTAATAAGTGGTGAGGCTAGCAAGGATGCAGCATGTTATCCAGTTGCTGCCAAAGTAGCCGAGCTTCTCATACG...

Protein

Download Protein FASTA

185 aa · TkA03G537680|TK1151|PROTEIN

MGHVHRFVGLSVGLIQELGFDYLRDNLAGSSGQLVMRWRKPFHFAIVDEVDSVLIDDGRNPLLISGEASKDAACYPVAAKVAELLIRGLLTGRVEEKRRWSEGIHQAVEAKEGLQIQADSVVVAQITYQSMFKLYPKLSGMTGTAKTEVMTFCALLHMGYMQEITTYSHIIYLLSILYNYRKKSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G537680`
TK1151 ID	TkA03G537680
OH-1004 ID	LXL04_000093
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.100
Protein coverage (%)	TK1151 80.541 / OH-1004 77.489 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G537680

Location Chr03:135363523-135365052 (-)

Description Similar to SECA2: Protein translocase subunit SECA2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21650`	Involved in protein export.	Plastids contain a second sec translocase system with essential functions.2011 · DOI: 10.1104/pp.110.166546

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000093 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006605 protein targeting Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0017038 protein import Biological Process

GO:0065002 intracellular protein transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G21650

cyb:CYB_2451

cyc:PCC7424_0032

cyn:Cyan7425_3658

gvi:gll1836

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.399

Rank 1 · TkA03G537680 · TK1151

Nucleus0.223

Rank 2 · TkA03G537680 · TK1151

Peroxisome0.162

Rank 3 · TkA03G537680 · TK1151

Mitochondrion0.144

Rank 4 · TkA03G537680 · TK1151

Extracellular0.118

Rank 5 · TkA03G537680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07517SecA_DEAD1-16 aa

PF07517SecA_DEAD16-150 aa

PF01043SecA_PP_bind90-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G537680	`PF07517`	SecA_DEAD	1	16	5e-39	135.0
TkA03G537680	`PF07517`	SecA_DEAD	16	150	5e-39	135.0
TkA03G537680	`PF01043`	SecA_PP_bind	90	109	3.4e-05	25.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`D8WUA4`	Arabidopsis thaliana	sp\|D8WUA4\|SECA2_ARATH Protein translocase subunit SECA2, chloroplastic	50.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card