TkA03G537390 | RubberDandelionOmics

Gene overview

TkA03G537390

Reference: TK1151 Chr: Chr03 Coordinates: 135272381-135275576 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

459 bp · TkA03G537390|TK1151|cDNA

ATAGACCATACCTCCATGTCTTAAACCCTCTCAGATTGTAAAAGAACACAAAACCCCCTGCCGAAAATCACAATATCCAACGCGAGTGACAAAGAGAGTAAGAGTTCGATGACAGGGAGTGCTAATCTGCTACAGCTATGGCAACTTCCTTACTCCACGCTGTTGTTCAATCGCACAAAGCTCTGTAAAGGTTTATACCCGTCACCAAGGATGAAAAATTATCCCCTGTGCTTCAGCAAACAGATGCAGACAACCACATA...

CDS

Download CDS FASTA

1353 bp · TkA03G537390|TK1151|CDS

ATGACAGGGAGTGCTAATCTGCTACAGCTATGGCAACTTCCTTACTCCACGCTGTTGTTCAATCGCACAAAGCTCTGTAAAGGTTTATACCCGTCACCAAGGATGAAAAATTATCCCCTGTGCTTCAGCAAACAGATGCAGACAACCACATATGAAGTTGTGAATGGAAGCTATTTAGAGACACCACATATTAAGCATGAAAACAAAACAAAGGATACAACACCTGAGACACTTGATACAGTTGGTGCCTTCCAAAAGCT...

Protein

Download Protein FASTA

450 aa · TkA03G537390|TK1151|PROTEIN

MTGSANLLQLWQLPYSTLLFNRTKLCKGLYPSPRMKNYPLCFSKQMQTTTYEVVNGSYLETPHIKHENKTKDTTPETLDTVGAFQKLPMVMPSVDILYSSLRKAKRISPTKGIANAAKREKNKGAKQLDALMKELTLPLRTYKDNFPNKRHLHPYEKSLIELTLGDGNYEEVLGRVDYLRKKVVSVGKEHASLCAQSTSKREAEERLIEGMRKLEEIFQSDGKAVDELMQIAKTLRAMPVVDLEMPTLCLVGAPNVGKSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G537390`
TK1151 ID	TkA03G537390
OH-1004 ID	LXL04_010620
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G537390`
Location	Chr03:135272381-135275576 (+)
Description	Similar to Gtpbp4: Nucleolar GTP-binding protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010620` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0008156 negative regulation of DNA replication Biological Process GO:0008285 negative regulation of cell population proliferation Biological Process GO:0010972 negative regulation of G2/M transition of mitotic cell cycle Biological Process GO:0022408 negative regulation of cell-cell adhesion Biological Process GO:0030336 negative regulation of cell migration Biological Process GO:0031397 negative regulation of protein ubiquitination Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0042273 ribosomal large subunit biogenesis Biological Process GO:0050821 protein stabilization Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G50920 ecu:ECU05_0800 hsa:23560 mmu:69237 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.883

Rank 1 · TkA03G537390 · TK1151

Cytoplasm0.094

Rank 2 · TkA03G537390 · TK1151

Nucleus0.079

Rank 3 · TkA03G537390 · TK1151

Plastid0.050

Rank 4 · TkA03G537390 · TK1151

Cell membrane0.028

Rank 5 · TkA03G537390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01926MMR_HSR176-83 aa

PF17835NOG1_N84-242 aa

PF10234Cluap1105-216 aa

PF08954Trimer_CC188-228 aa

PF10234Cluap1215-237 aa

PF05621TniB227-270 aa

PF00350Dynamin_N234-341 aa

PF02421FeoB_N247-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G537390	`PF01926`	MMR_HSR1	76	83	1.5e-16	61.3
TkA03G537390	`PF17835`	NOG1_N	84	242	3.7e-45	154.6
TkA03G537390	`PF10234`	Cluap1	105	216	0.011	15.9
TkA03G537390	`PF08954`	Trimer_CC	188	228	0.062	13.7
TkA03G537390	`PF10234`	Cluap1	215	237	0.011	15.9
TkA03G537390	`PF05621`	TniB	227	270	0.046	13.9
TkA03G537390	`PF00350`	Dynamin_N	234	341	0.11	13.2
TkA03G537390	`PF02421`	FeoB_N	247	304	6.2e-09	36.3
TkA03G537390	`PF01926`	MMR_HSR1	248	346	1.5e-16	61.3
TkA03G537390	`PF05621`	TniB	310	364	0.046	13.9
TkA03G537390	`PF06858`	NOG1	313	369	1.6e-18	66.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card