TkA03G537270 | RubberDandelionOmics

Gene overview

TkA03G537270

Reference: TK1151 Chr: Chr03 Coordinates: 135231768-135233677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1000 bp · TkA03G537270|TK1151|cDNA

AAACTGTTCTCATCTCCAACCGAAAGAGGAGATAAATCCGGCAACTCGCCGGACAATTTGTTGTGTGCGACATTTAAAACTTCAATATCTTCCACAGCCTCATAGCTTCATTCCCACCACTCAAATCAAACCCTCTGCAACTCCAAATCTGCAACTCCAAATCCCTAAATCAAAGTTCTCCTCACCATCACATTTTGTCATTTTAATGAAGTCGCAAAAGCTTTAATCTCTATAGCTTCCCCTTTTCCTTTTCAGTTTCA...

CDS

Download CDS FASTA

348 bp · TkA03G537270|TK1151|CDS

ATGTCGTCTTCATGTGCTACGTTACCGCATCGATTAAGAACTGAGTGGCCTACCACTAACAAGTTCAGTTCCATCGTCAAAGCTCAACCTTATAGAAATAGATGTGGTTTGAGTAGGAGAGATTTTGCTACGAAAGGAATTGTTACAGCTGGTGCTTCGGTGATGCCGTCTACTTTGCTATCTCAATCTGCTCAAGGTCACAAAATACATTACGTTGAAGAAGGAGAAGGTTTCCCCATTGTTCTTATTCATGGTTTTGG...

Protein

Download Protein FASTA

115 aa · TkA03G537270|TK1151|PROTEIN

MSSSCATLPHRLRTEWPTTNKFSSIVKAQPYRNRCGLSRRDFATKGIVTAGASVMPSTLLSQSAQGHKIHYVEEGEGFPIVLIHGFGASAFHWRYNIPELAKKYKVYAVDLLGFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G537270`
TK1151 ID	TkA03G537270
OH-1004 ID	LXL04_038031
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.700
Protein coverage (%)	TK1151 100.000 / OH-1004 72.678 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G537270`
Location	Chr03:135231768-135233677 (+)
Description	Similar to dmpD: 2-hydroxymuconate semialdehyde hydrolase (Pseudomonas sp. (strain CF600)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038031` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009636 response to toxic substance Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0016311 dephosphorylation Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0043640 benzoate catabolic process via hydroxylation Biological Process GO:0043651 linoleic acid metabolic process Biological Process GO:0045777 positive regulation of blood pressure Biological Process GO:0046272 stilbene catabolic process Biological Process GO:0046464 acylglycerol catabolic process Biological Process GO:0046839 phospholipid dephosphorylation Biological Process GO:0090181 regulation of cholesterol metabolic process Biological Process GO:0097176 epoxide metabolic process Biological Process
KEGG gene cross-reference	ag:CAA36993 mbo:BQ2027_MB2734 pau:PA14_26090 rno:65030 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.974

Rank 1 · TkA03G537270 · TK1151

Mitochondrion0.030

Rank 2 · TkA03G537270 · TK1151

Nucleus0.012

Rank 3 · TkA03G537270 · TK1151

Cytoplasm0.010

Rank 4 · TkA03G537270 · TK1151

Cell membrane0.006

Rank 5 · TkA03G537270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561Abhydrolase_179-115 aa

PF12697Abhydrolase_680-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G537270	`PF00561`	Abhydrolase_1	79	115	2.9e-06	27.9
TkA03G537270	`PF12697`	Abhydrolase_6	80	115	3.9e-06	28.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card