Gene Card
Gene overview
cDNA / CDS / Protein Sequences
465 bp · TkA03G534490|TK1151|cDNA
ATGAAGAGTTTCTGTTTTCTTCTATGCTTGGTTCTCCTAGCAGCCACTTCGTTGGATATCAATGCTCAAACTTGCAAACCAAGTGGTGGTATCCGGGGAAAAACACCACCACCTGGAGAATGCAACCAAGAGAACAACTCGGATTGTTGTGTCAAAGGTGATGGCGGTGGTCCATCTGAGTGTGACAACCAATACCACGATGATGACACACCAGTTGTGGCACTCTCAACCGGATGGTACAAGGGAGGGGATAGGTGCCA...
465 bp · TkA03G534490|TK1151|CDS
ATGAAGAGTTTCTGTTTTCTTCTATGCTTGGTTCTCCTAGCAGCCACTTCGTTGGATATCAATGCTCAAACTTGCAAACCAAGTGGTGGTATCCGGGGAAAAACACCACCACCTGGAGAATGCAACCAAGAGAACAACTCGGATTGTTGTGTCAAAGGTGATGGCGGTGGTCCATCTGAGTGTGACAACCAATACCACGATGATGACACACCAGTTGTGGCACTCTCAACCGGATGGTACAAGGGAGGGGATAGGTGCCA...
Protein
Download Protein FASTA154 aa · TkA03G534490|TK1151|PROTEIN
MKSFCFLLCLVLLAATSLDINAQTCKPSGGIRGKTPPPGECNQENNSDCCVKGDGGGPSECDNQYHDDDTPVVALSTGWYKGGDRCHKYITINGNGRSVKAMVVDECDSTMGCDGDHDYQPPCPNNIVDASKAVWKALGVSEDNWGDLDITWTM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G534490 |
|---|---|
| TK1151 ID | TkA03G534490 |
| OH-1004 ID | LXL04_004125 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 94.800 |
| Protein coverage (%) | TK1151 99.351 / OH-1004 42.265Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G534490 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:134451839-134452390 (-) | |||||||||
| Description | Similar to KWL1: Kiwellin-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0050832 defense response to fungus Biological Process GO:0051851 host-mediated perturbation of symbiont process Biological Process GO:0005576 extracellular region Cellular Component GO:0048046 apoplast Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function | |||||||||
| KEGG gene cross-reference | vvi:100233091 zma:103626138 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF29515Expansin_N1-117 aaPF27850Targ_of_XrtJ1-24 aaPF24300KWL122-53 aaPF24300KWL153-153 aaPF03330DPBB_190-142 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G534490 | PF29515 | Expansin_N | 1 | 117 | 0.00031 | 21.6 |
| TkA03G534490 | PF27850 | Targ_of_XrtJ | 1 | 24 | 0.24 | 11.8 |
| TkA03G534490 | PF24300 | KWL1 | 22 | 53 | 3.8e-42 | 144.9 |
| TkA03G534490 | PF24300 | KWL1 | 53 | 153 | 3.8e-42 | 144.9 |
| TkA03G534490 | PF03330 | DPBB_1 | 90 | 142 | 0.023 | 15.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.