TkA03G534420 | RubberDandelionOmics

Gene overview

TkA03G534420

Reference: TK1151 Chr: Chr03 Coordinates: 134431617-134432427 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · TkA03G534420|TK1151|cDNA

ATGGACCGGCCCTGGACTTTAGTGCTAGAAGAAGGACCAGAACTGATTAGTGGTTTGCGTAGTCTTCGGGTTCTTAATCTTTCTCACAATGGGTTCGTCGGGAAATTACCGGAGAGTTTGAGTTTTTTGAAGAATTTAAATGAGGTTTCGTTGAGCAATAAGCTTTCGGGTCCTGTGTATCAGAGTTTTGTAGAGAATATTCCGGCGAACGCCGTCGTTGATCTCTCATTCAACGCTCTAACCGGTCAAATCCCACAAAT...

CDS

Download CDS FASTA

444 bp · TkA03G534420|TK1151|CDS

ATGGACCGGCCCTGGACTTTAGTGCTAGAAGAAGGACCAGAACTGATTAGTGGTTTGCGTAGTCTTCGGGTTCTTAATCTTTCTCACAATGGGTTCGTCGGGAAATTACCGGAGAGTTTGAGTTTTTTGAAGAATTTAAATGAGGTTTCGTTGAGCAATAAGCTTTCGGGTCCTGTGTATCAGAGTTTTGTAGAGAATATTCCGGCGAACGCCGTCGTTGATCTCTCATTCAACGCTCTAACCGGTCAAATCCCACAAAT...

Protein

Download Protein FASTA

147 aa · TkA03G534420|TK1151|PROTEIN

MDRPWTLVLEEGPELISGLRSLRVLNLSHNGFVGKLPESLSFLKNLNEVSLSNKLSGPVYQSFVENIPANAVVDLSFNALTGQIPQMMSLSNQKEEYFAGNLDLCGKPLKKMCRIPSSHLIPTNVSSDGSATAAEFGEVTWVLLGRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G534420`
TK1151 ID	TkA03G534420
OH-1004 ID	LXL04_037811
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 94.558 / OH-1004 48.432 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G534420

Location Chr03:134431617-134432427 (-)

Description Similar to At4g34220: Receptor protein kinase-like protein At4g34220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34220`	Receptor protein kinase-like protein At4g34220.	No verified direct reference in this release
`At4g37250`	Probable LRR receptor-like serine/threonine-protein kinase At4g37250.	No verified direct reference in this release
`At2g01210`	Receptor protein kinase acting as an integrator for intracellular calcium and heterotrimeric G protein signaling with extracellular signals during early zygote development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037811 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G05660

ath:AT4G34220

ath:AT4G37250

ath:AT5G40170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.580

Rank 1 · TkA03G534420 · TK1151

Endoplasmic reticulum0.171

Rank 2 · TkA03G534420 · TK1151

Extracellular0.136

Rank 3 · TkA03G534420 · TK1151

Cytoplasm0.106

Rank 4 · TkA03G534420 · TK1151

Nucleus0.070

Rank 5 · TkA03G534420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855LRR_813-53 aa

PF13516LRR_620-31 aa

PF00560LRR_121-43 aa

PF12799LRR_421-55 aa

PF00560LRR_145-56 aa

PF13516LRR_645-52 aa

PF00560LRR_173-87 aa

PF12799LRR_473-84 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G534420	`PF13855`	LRR_8	13	53	0.00017	22.0
TkA03G534420	`PF13516`	LRR_6	20	31	0.011	16.5
TkA03G534420	`PF00560`	LRR_1	21	43	2.4e-06	27.3
TkA03G534420	`PF12799`	LRR_4	21	55	4e-05	24.4
TkA03G534420	`PF00560`	LRR_1	45	56	2.4e-06	27.3
TkA03G534420	`PF13516`	LRR_6	45	52	0.011	16.5
TkA03G534420	`PF00560`	LRR_1	73	87	2.4e-06	27.3
TkA03G534420	`PF12799`	LRR_4	73	84	4e-05	24.4
TkA03G534420	`PF13855`	LRR_8	73	82	0.00017	22.0
TkA03G534420	`PF13516`	LRR_6	73	82	0.011	16.5
TkA03G534420	`PF00560`	LRR_1	113	113	2.4e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94C77`	Arabidopsis thaliana	sp\|Q94C77\|RPKL_ARATH Receptor protein kinase-like protein At4g34220	49.600%	Swiss-Prot	Medium
`C0LGS3`	Arabidopsis thaliana	sp\|C0LGS3\|Y4372_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g37250	34.500%	Swiss-Prot	Medium
`Q9ZU46`	Arabidopsis thaliana	sp\|Q9ZU46\|ZAR1_ARATH Receptor protein kinase-like protein ZAR1	44.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card