TkA03G533190 | RubberDandelionOmics

Gene overview

TkA03G533190

Reference: TK1151 Chr: Chr03 Coordinates: 134100100-134101375 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

702 bp · TkA03G533190|TK1151|cDNA

ATGTTCAAGCCATGGTCATTTTACCCTTGTGTTTTGGAACCTGTTAAAAACCACGATCTTGATAGTGAAGAAAGCATTGCATCTAAAGTCAAAGTAGCTGTCATTGCAAGTCAAGGTGTTTCTGAACTTATGCCTCCAGAAATTGCCAAGACTTTGTGGCCCTTTGATAAAGCTTCTAGAAAGGTCTCAAGGGACGTTCGTGAGATTGTCAAGTTTGCAGTTAGTCAAGCAAAGAAACGTGATAAATTGTCAGAGTATAC...

CDS

Download CDS FASTA

702 bp · TkA03G533190|TK1151|CDS

ATGTTCAAGCCATGGTCATTTTACCCTTGTGTTTTGGAACCTGTTAAAAACCACGATCTTGATAGTGAAGAAAGCATTGCATCTAAAGTCAAAGTAGCTGTCATTGCAAGTCAAGGTGTTTCTGAACTTATGCCTCCAGAAATTGCCAAGACTTTGTGGCCCTTTGATAAAGCTTCTAGAAAGGTCTCAAGGGACGTTCGTGAGATTGTCAAGTTTGCAGTTAGTCAAGCAAAGAAACGTGATAAATTGTCAGAGTATAC...

Protein

Download Protein FASTA

233 aa · TkA03G533190|TK1151|PROTEIN

MFKPWSFYPCVLEPVKNHDLDSEESIASKVKVAVIASQGVSELMPPEIAKTLWPFDKASRKVSRDVREIVKFAVSQAKKRDKLSEYTNFRRITTSRGDLDPFDCLYVGAFGPYGTEVVQLRRKYGNWSGSNDIEFFEYVEAVKVTSDLNVPAGQVTFRAKLAKGSHFKNRGMYPDELGVVKVGLLNLVSKIQNGLKVNFSYSIARVWDHMSKVLTLVFSMLSLSKVFLYYLTV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G533190`
TK1151 ID	TkA03G533190
OH-1004 ID	LXL04_005520
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G533190

Location Chr03:134100100-134101375 (-)

Description Similar to EX2: Protein EXECUTER 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27510`	Together with EX1, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release
`At4g33630`	Together with EX2, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0107900`	Together with EX1, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release
`Os10g0485300`	Together with EX2, enables higher plants to perceive singlet oxygen as a stress signal in plastid that activates a genetically determined nuclear stress response program which triggers a programmed cell death (PCD).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005520 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000304 response to singlet oxygen Biological Process

GO:0010343 singlet oxygen-mediated programmed cell death Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0042651 thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT1G27510

ath:AT4G33630

dosa:Os01g0107900

dosa:Os10g0485300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.436

Rank 1 · TkA03G533190 · TK1151

Cytoplasm0.410

Rank 2 · TkA03G533190 · TK1151

Cell membrane0.101

Rank 3 · TkA03G533190 · TK1151

Endoplasmic reticulum0.085

Rank 4 · TkA03G533190 · TK1151

Mitochondrion0.081

Rank 5 · TkA03G533190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02441Flavoprotein28-66 aa

PF12014Cyclin_D1_bind89-169 aa

PF02441Flavoprotein185-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G533190	`PF02441`	Flavoprotein	28	66	0.086	13.3
TkA03G533190	`PF12014`	Cyclin_D1_bind	89	169	4.5e-16	60.3
TkA03G533190	`PF02441`	Flavoprotein	185	220	0.086	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94AT5`	Arabidopsis thaliana	sp\|Q94AT5\|EXEC2_ARATH Protein EXECUTER 2, chloroplastic	59.900%	Swiss-Prot	Medium
`Q93YW0`	Arabidopsis thaliana	sp\|Q93YW0\|EXEC1_ARATH Protein EXECUTER 1, chloroplastic	45.700%	Swiss-Prot	Medium
`Q657X6`	Oryza sativa subsp. japonica	sp\|Q657X6\|EXEC2_ORYSJ Protein EXECUTER 2, chloroplastic	54.500%	Swiss-Prot	High
`Q7XD99`	Oryza sativa subsp. japonica	sp\|Q7XD99\|EXEC1_ORYSJ Protein EXECUTER 1, chloroplastic	35.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card