TkA03G528300 | RubberDandelionOmics

Gene overview

TkA03G528300

Reference: TK1151 Chr: Chr03 Coordinates: 132780623-132782716 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1274 bp · TkA03G528300|TK1151|cDNA

GGAAAATAAAATGATACTCCAAGAAAACTAATAAACTTCCCGCGTTTATCCCCTCCGCCAAACCAACCACGTTAAACCCTACATTGAAAATCCCCCAATTCAATCAAATTGGTCCTTCCAACCGGAGTCAAGAAGCCTATTCGGTACCTTAATTCAATCGAAACTATGCCGCAAGCCAATCAACCAGATTCAGAGACAGAAGCAACGGGCTCTGACAATACCCTACGGAGTAAAGGGACTAAGGGATCAGCGAATATGAC...

CDS

Download CDS FASTA

873 bp · TkA03G528300|TK1151|CDS

ATGCCGCAAGCCAATCAACCAGATTCAGAGACAGAAGCAACGGGCTCTGACAATACCCTACGGAGTAAAGGGACTAAGGGATCAGCGAATATGACCGAGTACGAGAAACAGAGAATGAAAAGAATTGAAGAAAACAAGGCGAGAATGAGAGCAATGGGTTTAGATAAAATGGCGTCTTCGTTTATGGGTTCTGTTCCTGTTTCTCAAAACTCGAAGAAAAAGGGTAAAAAGAAGGTGGGTTTGGAAGGCGATGAGGAGTA...

Protein

Download Protein FASTA

290 aa · TkA03G528300|TK1151|PROTEIN

MPQANQPDSETEATGSDNTLRSKGTKGSANMTEYEKQRMKRIEENKARMRAMGLDKMASSFMGSVPVSQNSKKKGKKKVGLEGDEEYKPPGKDDDLSSSSGSDGDDYDDEFPKSQTKSKAKKSTPSKKVSKSSRHLDFVHDDDDDALMKAIALSLQDSPGFLDVMTKTPPKKSEANASVVENTESKQIVHKDDSGNRKRKNSFASRVQMTEDELILHFFHFDEVGKGGISLRDLRRVGASHDFTWTDEEMKHMIDFFDTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G528300`
TK1151 ID	TkA03G528300
OH-1004 ID	LXL04_024996
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.600
Protein coverage (%)	TK1151 52.759 / OH-1004 99.346 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G528300`
Location	Chr03:132780623-132782716 (-)
Description	Similar to Cetn1: Centrin-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_024996` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000226 microtubule cytoskeleton organization Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006406 mRNA export from nucleus Biological Process GO:0007098 centrosome cycle Biological Process GO:0007099 centriole replication Biological Process GO:0007283 spermatogenesis Biological Process GO:0015031 protein transport Biological Process GO:0032465 regulation of cytokinesis Biological Process GO:0034605 cellular response to heat Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0051028 mRNA transport Biological Process
KEGG gene cross-reference	bta:512850 hsa:1069 hsa:1070 mmu:12626 mmu:26369 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA03G528300 · TK1151

Cytoplasm0.078

Rank 2 · TkA03G528300 · TK1151

Cell membrane0.023

Rank 3 · TkA03G528300 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA03G528300 · TK1151

Plastid0.011

Rank 5 · TkA03G528300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04277OAD_gamma66-78 aa

PF04277OAD_gamma116-154 aa

PF21909USP_UIM_N136-159 aa

PF23625UIM_2142-158 aa

PF02809UIM142-158 aa

PF10484MRP-S23146-196 aa

PF04277OAD_gamma167-188 aa

PF13833EF-hand_8206-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G528300	`PF04277`	OAD_gamma	66	78	3.5	9.1
TkA03G528300	`PF04277`	OAD_gamma	116	154	3.5	9.1
TkA03G528300	`PF21909`	USP_UIM_N	136	159	0.029	15.2
TkA03G528300	`PF23625`	UIM_2	142	158	0.018	15.8
TkA03G528300	`PF02809`	UIM	142	158	0.049	14.2
TkA03G528300	`PF10484`	MRP-S23	146	196	0.077	13.9
TkA03G528300	`PF04277`	OAD_gamma	167	188	3.5	9.1
TkA03G528300	`PF13833`	EF-hand_8	206	234	3.3e-07	30.7
TkA03G528300	`PF13499`	EF-hand_7	212	274	2.3e-06	28.6
TkA03G528300	`PF13405`	EF-hand_6	217	236	7.3e-05	22.9
TkA03G528300	`PF00036`	EF-hand_1	220	237	0.0002	21.4
TkA03G528300	`PF13202`	EF-hand_5	225	237	0.0032	17.6
TkA03G528300	`PF13833`	EF-hand_8	226	276	3.3e-07	30.7
TkA03G528300	`PF13405`	EF-hand_6	249	275	7.3e-05	22.9
TkA03G528300	`PF00036`	EF-hand_1	249	275	0.0002	21.4
TkA03G528300	`PF13202`	EF-hand_5	251	273	0.0032	17.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card