TkA03G522030 | RubberDandelionOmics

Gene overview

TkA03G522030

Reference: TK1151 Chr: Chr03 Coordinates: 130985795-130987823 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · TkA03G522030|TK1151|cDNA

ATGAGGCTTGAAGAGAGAACACCGCTTATGATTGCCTCCATGTTCGGTAGCAAACATGTTCTGAAGTTCATTCTCGGATTAAATCGAGTTGATGTAAACAAATCCTGTGGTTCCGATAGGGCTACTGCTTTACACAAATCGAGTTCATCCATAGAGGTGGTCAAGCTTTTGCTCAACTTGTCTGCTGATATCATCTCCCTCGATGTTCACAGGAATCTACCTGTTGACTTAAATCCTTTAGTGTTCGGTTCTTCTTTCAA...

CDS

Download CDS FASTA

639 bp · TkA03G522030|TK1151|CDS

ATGAGGCTTGAAGAGAGAACACCGCTTATGATTGCCTCCATGTTCGGTAGCAAACATGTTCTGAAGTTCATTCTCGGATTAAATCGAGTTGATGTAAACAAATCCTGTGGTTCCGATAGGGCTACTGCTTTACACAAATCGAGTTCATCCATAGAGGTGGTCAAGCTTTTGCTCAACTTGTCTGCTGATATCATCTCCCTCGATGTTCACAGGAATCTACCTGTTGACTTAAATCCTTTAGTGTTCGGTTCTTCTTTCAA...

Protein

Download Protein FASTA

212 aa · TkA03G522030|TK1151|PROTEIN

MRLEERTPLMIASMFGSKHVLKFILGLNRVDVNKSCGSDRATALHKSSSSIEVVKLLLNLSADIISLDVHRNLPVDLNPLVFGSSFNSKRVSNRPLSPRHEYFQNQTMFTSLLSQLDRIPPTSTSPPLWFESSPTMKVSTSRFRATTSRRGLSDGLLGSLIWSRASRRVGPLYQSRLVDLSIMLSPSNPEIRTKGISGLLILTSKVKINLFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G522030`
TK1151 ID	TkA03G522030
OH-1004 ID	LXL04_036567
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.200
Protein coverage (%)	TK1151 42.453 / OH-1004 16.267 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G522030

Location Chr03:130985795-130987823 (-)

Description Similar to At5g58620: Zinc finger CCCH domain-containing protein 66

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58620`	Zinc finger CCCH domain-containing protein 66.	No verified direct reference in this release
`At5g12850`	Zinc finger CCCH domain-containing protein 56.	No verified direct reference in this release
`At3g55980`	Involved in salt stress response.	No verified direct reference in this release
`At2g40140`	Involved in salt stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0698800`	Zinc finger CCCH domain-containing protein 24.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006412 translation Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902074 response to salt Biological Process

GO:0000932 P-body Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

KEGG gene cross-reference

ath:AT2G40140

ath:AT2G41900

ath:AT3G55980

ath:AT5G12850

ath:AT5G58620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.384

Rank 1 · TkA03G522030 · TK1151

Nucleus0.383

Rank 2 · TkA03G522030 · TK1151

Mitochondrion0.147

Rank 3 · TkA03G522030 · TK1151

Cell membrane0.075

Rank 4 · TkA03G522030 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA03G522030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796Ank_24-65 aa

PF13857Ank_54-44 aa

PF00023Ank6-34 aa

PF13606Ank_36-33 aa

PF13637Ank_46-24 aa

PF13637Ank_410-58 aa

PF13857Ank_530-77 aa

PF00023Ank41-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G522030	`PF12796`	Ank_2	4	65	2.4e-07	31.9
TkA03G522030	`PF13857`	Ank_5	4	44	0.0019	19.3
TkA03G522030	`PF00023`	Ank	6	34	4.3e-07	30.6
TkA03G522030	`PF13606`	Ank_3	6	33	3e-05	24.7
TkA03G522030	`PF13637`	Ank_4	6	24	0.00032	21.7
TkA03G522030	`PF13637`	Ank_4	10	58	0.00032	21.7
TkA03G522030	`PF13857`	Ank_5	30	77	0.0019	19.3
TkA03G522030	`PF00023`	Ank	41	65	4.3e-07	30.6
TkA03G522030	`PF13606`	Ank_3	48	64	3e-05	24.7
TkA03G522030	`PF13637`	Ank_4	48	65	0.00032	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUZ4`	Arabidopsis thaliana	sp\|Q9LUZ4\|C3H66_ARATH Zinc finger CCCH domain-containing protein 66	53.700%	Swiss-Prot	Low
`Q9LXV4`	Arabidopsis thaliana	sp\|Q9LXV4\|C3H56_ARATH Zinc finger CCCH domain-containing protein 56	51.200%	Swiss-Prot	Low
`Q93ZS9`	Arabidopsis thaliana	sp\|Q93ZS9\|C3H47_ARATH Zinc finger CCCH domain-containing protein 47	47.600%	Swiss-Prot	Low
`Q9XEE6`	Arabidopsis thaliana	sp\|Q9XEE6\|C3H29_ARATH Zinc finger CCCH domain-containing protein 29	46.300%	Swiss-Prot	Low
`Q10EL1`	Oryza sativa subsp. japonica	sp\|Q10EL1\|C3H24_ORYSJ Zinc finger CCCH domain-containing protein 24	48.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card