Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3264 bp · TkA03G512880|TK1151|cDNA
TGCCAAATGACATGATCAACTCCATAGTAAACATGTATATGTTGTTCTAATTATTGCGATTTGAATGTTCACCTAAAACCGTTGGAAAAAGCTGCTAACTCAAAATTCGGTAACTCCTCACCCTTTTCCCTCCACCAACATGGATAAGATTTTGTCCAACTGCTTCCTACAAAAGAATAGAATTCCAAGCTCCATTCATCCATGGAGCTCTGCAATTTATTCTTTATCACCACTCCCATAAAACCCTCATTTCCAAATCT...
2628 bp · TkA03G512880|TK1151|CDS
ATGGAGCTCTGCAATTTATTCTTTATCACCACTCCCATAAAACCCTCATTTCCAAATCTCAAGACCCGTTTAGTTAAATGCTCGGCGGATACGCCGACTCGCCGAATCAAACTCGCGGAGTCACTCCAGGATGAGACGTTCAGAATTCTCGAATGGCCGTCGGTGTGTAACCAGGTCTCCGCCTTCACTTCCACTACCATGGGAACTTCGGCCGCCCGAGAAGGTCTGGTTCCTATAGGACGGAGCCCTGATGAGAGCCG...
Protein
Download Protein FASTA875 aa · TkA03G512880|TK1151|PROTEIN
MELCNLFFITTPIKPSFPNLKTRLVKCSADTPTRRIKLAESLQDETFRILEWPSVCNQVSAFTSTTMGTSAAREGLVPIGRSPDESRRLLNQTSAAVALPSPPDFSGIEDVSDIIKSSVARQLLSIGEICAVKRTLRSARVLFEQLKKISLQSERYYPLLEILQNCNFLTDLEQKIEYCIDSKFSVILDRASEDLELIRSERKNNMEDLDSLLKNVSTKIFRAGGIDKPLVTKRRSRMCVGVKASHKSLLPNGVVLDASS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G512880 |
|---|---|
| TK1151 ID | TkA03G512880 |
| OH-1004 ID | LXL04_010228 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 99.771 / OH-1004 96.040Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G512880 |
|---|---|
| Location | Chr03:128667272-128671069 (+) |
| Description | Similar to mutS2: Endonuclease MutS2 (Synechocystis sp. (strain PCC 6803 / Kazusa) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006298 mismatch repair Biological Process GO:0045910 negative regulation of DNA recombination Biological Process GO:0072344 rescue of stalled cytosolic ribosome Biological Process GO:0003690 double-stranded DNA binding Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0019843 rRNA binding Molecular Function GO:0030983 mismatched DNA binding Molecular Function GO:0043023 ribosomal large subunit binding Molecular Function GO:0140664 ATP-dependent DNA damage sensor activity Molecular Function |
| KEGG gene cross-reference | bcl:ABC2675 cbi:CLJ_B3388 cno:NT01CX_1773 hor:Hore_05680 syn:sll1772 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02251PA28_N32-56 aaPF12631MnmE_helical104-240 aaPF13173AAA_14167-183 aaPF15665FAM184188-211 aaPF00488MutS_V233-259 aaPF24850CC_BshC242-293 aaPF26904Phage_T4_Y05Q274-307 aaPF13401AAA_22393-509 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G512880 | PF02251 | PA28_N | 32 | 56 | 0.69 | 10.7 |
| TkA03G512880 | PF12631 | MnmE_helical | 104 | 240 | 0.016 | 16.0 |
| TkA03G512880 | PF13173 | AAA_14 | 167 | 183 | 4.3 | 8.1 |
| TkA03G512880 | PF15665 | FAM184 | 188 | 211 | 0.0011 | 19.5 |
| TkA03G512880 | PF00488 | MutS_V | 233 | 259 | 2.4e-33 | 116.4 |
| TkA03G512880 | PF24850 | CC_BshC | 242 | 293 | 0.04 | 14.5 |
| TkA03G512880 | PF26904 | Phage_T4_Y05Q | 274 | 307 | 0.3 | 12.4 |
| TkA03G512880 | PF13401 | AAA_22 | 393 | 509 | 0.21 | 12.6 |
| TkA03G512880 | PF13173 | AAA_14 | 394 | 487 | 4.3 | 8.1 |
| TkA03G512880 | PF00488 | MutS_V | 397 | 581 | 2.4e-33 | 116.4 |
| TkA03G512880 | PF24915 | Spectrin_SESTD1 | 446 | 495 | 0.54 | 11.4 |
| TkA03G512880 | PF12631 | MnmE_helical | 447 | 469 | 0.016 | 16.0 |
| TkA03G512880 | PF08020 | DUF1706 | 449 | 477 | 0.25 | 12.0 |
| TkA03G512880 | PF02251 | PA28_N | 566 | 608 | 0.69 | 10.7 |
| TkA03G512880 | PF15665 | FAM184 | 578 | 697 | 0.0011 | 19.5 |
| TkA03G512880 | PF25553 | BTB-POZ_ANK-like | 590 | 659 | 0.22 | 11.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.