Gene Card
Gene overview
cDNA / CDS / Protein Sequences
348 bp · TkA03G512410|TK1151|cDNA
ATGATTAAGGCTCATCTGATTTTAAGTCTGTCCGGCCTGATTTTTAGTAGGTTGGCTGATTTTTCATCTGTTTTGACTGATTTTAACTCTATTTGGTGTGATTTCGGGTCGGAACCCGATCCAAACCCGACCCGGGTATATAAGAAATTAAACCCTAAATTTCTCCATTCTTCTCCAATCCGGCCGCGAACACAGGTCTTTCTCTCACCCCGGCGATTTCCGGCGACACTCTACAGGTGCCATTTCCGGCGATTTTCCGA...
348 bp · TkA03G512410|TK1151|CDS
ATGATTAAGGCTCATCTGATTTTAAGTCTGTCCGGCCTGATTTTTAGTAGGTTGGCTGATTTTTCATCTGTTTTGACTGATTTTAACTCTATTTGGTGTGATTTCGGGTCGGAACCCGATCCAAACCCGACCCGGGTATATAAGAAATTAAACCCTAAATTTCTCCATTCTTCTCCAATCCGGCCGCGAACACAGGTCTTTCTCTCACCCCGGCGATTTCCGGCGACACTCTACAGGTGCCATTTCCGGCGATTTTCCGA...
Protein
Download Protein FASTA115 aa · TkA03G512410|TK1151|PROTEIN
MIKAHLILSLSGLIFSRLADFSSVLTDFNSIWCDFGSEPDPNPTRVYKKLNPKFLHSSPIRPRTQVFLSPRRFPATLYRCHFRRFSDETRRLQPFPPVIPLSRLLVVRREAKSPT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G512410 |
|---|---|
| TK1151 ID | TkA03G512410 |
| OH-1004 ID | LXL04_024897 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 63.000 |
| Protein coverage (%) | TK1151 66.957 / OH-1004 31.034Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G512410 |
|---|---|
| Location | Chr03:128551120-128551467 (+) |
| Description | Similar to NDT1: Nicotinamide adenine dinucleotide transporter 1, chloroplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006850 pyruvate import into mitochondria Biological Process GO:0035352 NAD transmembrane transport Biological Process GO:0043132 NAD transport Biological Process GO:0160007 glutathione import into mitochondrion Biological Process GO:1990542 mitochondrial transmembrane transport Biological Process GO:1990549 mitochondrial NAD transmembrane transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0015297 antiporter activity Molecular Function |
| KEGG gene cross-reference | ath:AT1G25380 ath:AT2G47490 dme:Dmel_CG14209 sce:YIL006W spo:2541928 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.