RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G508660
Reference: TK1151 Chr: Chr03 Coordinates: 127532570-127537031 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3404 bp · TkA03G508660|TK1151|cDNA

AAGAAATAAACCGCTTCAATCATGCTCCGAACAACTTTCTCTCTCTAAAGACACCTTCTCTCTCTCAAACACTGTGCACATCACCAACCGGCCAAAACCAGGCTCGGCGTTCGAGAAAAAGTGAAATTCTCATCTTTCTCCGGTGGATTTTTCGAAGAAACCTCTGGTTACATCATTTCGATTCAATTTTGTATATAAAAGTCGGTGTATATCGGTATATACATACATACATACATGATACATTTATACACATACATGTG...

CDS

Download CDS FASTA

1935 bp · TkA03G508660|TK1151|CDS

ATGGACACTAATTTGAAGATATGGGATATTCGAAAGAAAGGATGCATTCATACATATAAAGGTCATAAACGAGCAATTAGTACAATCAGATTTACTCCTGATGGTCGTTGGGTAGTGTCTGGAGGACTTGATAATGTCGTAAAGATTTGGGACTTAACTGCTGGAAAGCTTTTGCATGAGTTTAAGTTACATGAAGGGCATATTAAATCCATGGATTTCCATCCTCTTGAGTTTCTTCTAGCTACAGGTTCATCAGACAG...

Protein

Download Protein FASTA

644 aa · TkA03G508660|TK1151|PROTEIN

MDTNLKIWDIRKKGCIHTYKGHKRAISTIRFTPDGRWVVSGGLDNVVKIWDLTAGKLLHEFKLHEGHIKSMDFHPLEFLLATGSSDRTVKFWDLETFELIGTTRPEATGVRSITFHPDGRTLFCGLDNSLKVYSWEPIICHDGVDIGWSTLGDLCIDNGKLLGCSYFQNSIRVWAADVSNIEPYAHSMSSMESKIDLQESGLERIKTPRKTFVPPDDDTKDIKNIYVDSMTPVSRKDGSNSNTNVHRRLFTDDVAIDSSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G508660
TK1151 IDTkA03G508660
OH-1004 IDLXL04_010173
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)97.900
Protein coverage (%)TK1151 81.832 / OH-1004 69.069
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G508660
LocationChr03:127532570-127537031 (-)
DescriptionSimilar to At5g23430: Katanin p80 WD40 repeat-containing subunit B1 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g61210 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity).
DWA3, an Arabidopsis DWD protein, acts as a negative regulator in ABA signal transduction.2011 · DOI: 10.1016/j.plantsci.2010.10.008
At1g11160 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity). No verified direct reference in this release
At5g08390 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity). No verified direct reference in this release
At5g23430 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_010173 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007019 microtubule depolymerization Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0051013 microtubule severing Biological Process
GO:0051510 regulation of unidimensional cell growth Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005874 microtubule Cellular Component
GO:0008352 katanin complex Cellular Component
GO:0015630 microtubule cytoskeleton Cellular Component
GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
GO:0008017 microtubule binding Molecular Function
KEGG gene cross-reference
ath:AT1G11160
ath:AT1G61210
ath:AT5G23430
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.658
Rank 1 · TkA03G508660 · TK1151
Nucleus0.203
Rank 2 · TkA03G508660 · TK1151
Cell membrane0.159
Rank 3 · TkA03G508660 · TK1151
Golgi apparatus0.114
Rank 4 · TkA03G508660 · TK1151
Lysosome / Vacuole0.081
Rank 5 · TkA03G508660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24814WD40_Prp191-130 aa
PF29037DSE1_N1-31 aa
PF25460Beta-prop_Aladin1-75 aa
PF23761Beta-prop_DCAF41-59 aa
PF25173Beta-prop_WDR3_1st2-134 aa
PF25175Beta-prop_WDR52-137 aa
PF00400WD402-9 aa
PF23381Beta-prop_IFT122_1st2-129 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G508660PF24814WD40_Prp1911301.1e-2591.0
TkA03G508660PF29037DSE1_N1319.6e-0935.5
TkA03G508660PF25460Beta-prop_Aladin1754.7e-0730.0
TkA03G508660PF23761Beta-prop_DCAF41591e-0628.6
TkA03G508660PF25173Beta-prop_WDR3_1st21342.3e-29103.1
TkA03G508660PF25175Beta-prop_WDR521371.6e-2797.2
TkA03G508660PF00400WD40293.6e-2794.3
TkA03G508660PF23381Beta-prop_IFT122_1st21296.3e-2795.3
TkA03G508660PF24807WD40_CDC20-Fz21274.9e-1969.5
TkA03G508660PF25168Beta-prop_WDR36-Utp21_2nd2828.9e-1968.6
TkA03G508660PF25391WD40_Gbeta21352.9e-1556.8
TkA03G508660PF24817WD40_WDHD1_1st2621.8e-1351.1
TkA03G508660PF25047Beta-prop_TEP1_2nd2698.4e-1142.2
TkA03G508660PF25048Beta-prop_TEP1_C2139.2e-0935.9
TkA03G508660PF23609Beta-prop_EIPR12920.0001322.2
TkA03G508660PF08662eIF2A2650.001519.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4HTH8Arabidopsis thalianasp|F4HTH8|KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.227.600%Swiss-ProtLow
A0A1P8AW69Arabidopsis thalianasp|A0A1P8AW69|KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.127.100%Swiss-ProtLow
F4KB17Arabidopsis thalianasp|F4KB17|KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.329.600%Swiss-ProtLow
Q8H0T9Arabidopsis thalianasp|Q8H0T9|KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.428.400%Swiss-ProtLow

JBrowse

View in Genome Browser