TkA03G508350 | RubberDandelionOmics

Gene overview

TkA03G508350

Reference: TK1151 Chr: Chr03 Coordinates: 127423662-127427215 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1188 bp · TkA03G508350|TK1151|cDNA

CACAACACCAAGTTCAACTGTGGCCTTGACTCTTTCTTTAGAATAGAATTTGAAAAATGAGGTATTTAAGATTATGGTTGGTTTGTTTTCTTGGATTCGTTTTAAGTACCGGACTTGGCGGTGTTCAAGCTTGGAGCAAAGAGGGACACGTCATGACATGCCAAATAGCACAAGATCTACTTGAACCACAAGCAGCACATGTTGTACGGATGTTGTTGCCAGATTACGTTGACGGTAACCTATCAGCGTTATGTGTGTGG...

CDS

Download CDS FASTA

903 bp · TkA03G508350|TK1151|CDS

ATGAGGTATTTAAGATTATGGTTGGTTTGTTTTCTTGGATTCGTTTTAAGTACCGGACTTGGCGGTGTTCAAGCTTGGAGCAAAGAGGGACACGTCATGACATGCCAAATAGCACAAGATCTACTTGAACCACAAGCAGCACATGTTGTACGGATGTTGTTGCCAGATTACGTTGACGGTAACCTATCAGCGTTATGTGTGTGGCCTGATCAGATTCGACATTGGTACCGATACCGATGGACTAGTCCTCTCCATTTCAT...

Protein

Download Protein FASTA

300 aa · TkA03G508350|TK1151|PROTEIN

MRYLRLWLVCFLGFVLSTGLGGVQAWSKEGHVMTCQIAQDLLEPQAAHVVRMLLPDYVDGNLSALCVWPDQIRHWYRYRWTSPLHFIDTPDNACSYDYSRDCHDTSGKKDMCVAGAIQNFTSQLSHYHEGSSDRRHNMTEALLFLSHFMGDIHQPMHVGFTSDEGGNTINLRWFRHKSNLHHVWDREIILTAAADFYEKDMESLQKAIKANFTHGLWSEDVTSWKDCDYLNTCINKYATESINLACKWGYKGVKAGETLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G508350`
TK1151 ID	TkA03G508350
OH-1004 ID	LXL04_010158
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 86.667 / OH-1004 73.864 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G508350

Location Chr03:127423662-127427215 (+)

Description Similar to ENDO1: Endonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11190`	Endonuclease that can use RNA, single-stranded and double- stranded DNA as substrates.	Identification of BFN1, a bifunctional nuclease induced during leaf and stem senescence in Arabidopsis.2000 · DOI: 10.1104/pp.122.1.169 Characterization of Arabidopsis thaliana mismatch specific endonucleases: application to mutation discovery by TILLING in pea.2007 · DOI: 10.1111/j.1365-313x.2007.03201.x Expression analysis of the BFN1 nuclease gene promoter during senescence, abscission, and programmed cell death-related processes.2008 · DOI: 10.1093/jxb/ern176
`At4g21585`	Endonuclease that can use single-stranded RNA and DNA as substrates.	No verified direct reference in this release
`At1g68290`	Endonuclease mostly active on RNA and ssDNA, and to a lower extent, on dsDNA.	Arabidopsis ENDO2: its catalytic role and requirement of N-glycosylation for function.2012 · DOI: 10.1021/jf300945c
`At4g21600`	Hydrolyzes, with low efficiency, only single-stranded DNA and RNA without apparent specificity for bases.	No verified direct reference in this release
`At4g21590`	Endonuclease that can use RNA and single-stranded DNA as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010158 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006308 DNA catabolic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0080187 floral organ senescence Biological Process

GO:0005576 extracellular region Cellular Component

GO:0000014 single-stranded DNA endodeoxyribonuclease activity Molecular Function

GO:0003676 nucleic acid binding Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0004521 RNA endonuclease activity Molecular Function

GO:0016891 RNA endonuclease activity producing 5'-phosphomonoesters, hydrolytic mechanism Molecular Function

GO:0043765 T/G mismatch-specific endonuclease activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:1990238 double-stranded DNA endonuclease activity Molecular Function

KEGG gene cross-reference

ath:AT1G11190

ath:AT1G68290

ath:AT4G21585

ath:AT4G21590

ath:AT4G21600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.377

Rank 1 · TkA03G508350 · TK1151

Lysosome / Vacuole0.342

Rank 2 · TkA03G508350 · TK1151

Cell membrane0.198

Rank 3 · TkA03G508350 · TK1151

Cytoplasm0.187

Rank 4 · TkA03G508350 · TK1151

Endoplasmic reticulum0.113

Rank 5 · TkA03G508350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02265S1-P1_nuclease26-290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G508350	`PF02265`	S1-P1_nuclease	26	290	2e-89	300.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SXA6`	Arabidopsis thaliana	sp\|Q9SXA6\|ENDO1_ARATH Endonuclease 1	70.600%	Swiss-Prot	High
`F4JJL0`	Arabidopsis thaliana	sp\|F4JJL0\|ENDO4_ARATH Endonuclease 4	53.100%	Swiss-Prot	High
`Q9C9G4`	Arabidopsis thaliana	sp\|Q9C9G4\|ENDO2_ARATH Endonuclease 2	54.100%	Swiss-Prot	High
`F4JJL3`	Arabidopsis thaliana	sp\|F4JJL3\|ENDO5_ARATH Endonuclease 5	48.600%	Swiss-Prot	Medium
`Q8LDW6`	Arabidopsis thaliana	sp\|Q8LDW6\|ENDO3_ARATH Endonuclease 3	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card