TkA03G508280 | RubberDandelionOmics

Gene overview

TkA03G508280

Reference: TK1151 Chr: Chr03 Coordinates: 127403242-127405923 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2035 bp · TkA03G508280|TK1151|cDNA

CTAACTTAACTCTAACACTCTACTTCTCACTTTCAACAATCTGCTTCTGAACAAGATTTAAAAATCTGTATATATCTCCCCCTCCTTTTTTATTTCATTCTTTGACCTCATTCTTTTTCTAAATCGTCCAATTATCACCCTGTTCTACCTCTCACTGATTAAGAGAATATGAAGCAATGGGATATGAAAACCACATTTTTTATATTCGTGTTCATAACAATGATAAAAACCATTAATGGAGAAGACCCTTATAGATTCTT...

CDS

Download CDS FASTA

1635 bp · TkA03G508280|TK1151|CDS

ATGAAGCAATGGGATATGAAAACCACATTTTTTATATTCGTGTTCATAACAATGATAAAAACCATTAATGGAGAAGACCCTTATAGATTCTTCAACTGGAATGTTACTTATGGTGATATCAATCCTCTTGGAGTTAATCAACAGGGGATACTTATAAACGGCCAGTTTCCAGGCCCACAAATGGATTGGGTCACTGACGACAATGTGATTGTAAATATTTACAACAGCTTGAATGTACCATTTCTCATTACATGGAACGG...

Protein

Download Protein FASTA

544 aa · TkA03G508280|TK1151|PROTEIN

MKQWDMKTTFFIFVFITMIKTINGEDPYRFFNWNVTYGDINPLGVNQQGILINGQFPGPQMDWVTDDNVIVNIYNSLNVPFLITWNGIDQRRNSWQDGVYGTNCPIPPGQNFTYNLQVKDQIGSFFYFPSLDFHRAAGGFGGITISNRPLIPVPFPPPAGDFTILAGDWFKQSHTDLKAILDGGHDLPFPDGLLINGRGSNGLTITVYQGRTYRLRISNVGLTTSINFRIQGHKMLLVEVEGTHTRQNIYTSLDIHLGQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G508280`
TK1151 ID	TkA03G508280
OH-1004 ID	LXL04_010156
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G508280

Location Chr03:127403242-127405923 (-)

Description Similar to L-ascorbate oxidase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55560`	Probable oxidoreductase that may be involved in pollen tube growth.	Two Arabidopsis late pollen transcripts are detected in cytoplasmic granules.2017 · DOI: 10.1002/pld3.12
`At4g12420`	May be a monocopper oxidase of unknown specificity.	No verified direct reference in this release
`At4g25240`	Monocopper oxidase-like protein SKS1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010156 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55560

ath:AT4G12420

ath:AT5G51480

bna:106452325

nta:107766889

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.824

Rank 1 · TkA03G508280 · TK1151

Cytoplasm0.062

Rank 2 · TkA03G508280 · TK1151

Cell membrane0.048

Rank 3 · TkA03G508280 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA03G508280 · TK1151

Nucleus0.028

Rank 5 · TkA03G508280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732Cu-oxidase_334-148 aa

PF00394Cu-oxidase46-55 aa

PF07731Cu-oxidase_289-139 aa

PF00394Cu-oxidase161-298 aa

PF31114DUF8814185-221 aa

PF07731Cu-oxidase_2200-244 aa

PF07732Cu-oxidase_3202-235 aa

PF31114DUF8814316-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G508280	`PF07732`	Cu-oxidase_3	34	148	2.5e-39	134.8
TkA03G508280	`PF00394`	Cu-oxidase	46	55	5.5e-42	144.2
TkA03G508280	`PF07731`	Cu-oxidase_2	89	139	1.6e-30	106.4
TkA03G508280	`PF00394`	Cu-oxidase	161	298	5.5e-42	144.2
TkA03G508280	`PF31114`	DUF8814	185	221	0.099	13.1
TkA03G508280	`PF07731`	Cu-oxidase_2	200	244	1.6e-30	106.4
TkA03G508280	`PF07732`	Cu-oxidase_3	202	235	2.5e-39	134.8
TkA03G508280	`PF31114`	DUF8814	316	354	0.099	13.1
TkA03G508280	`PF00394`	Cu-oxidase	355	451	5.5e-42	144.2
TkA03G508280	`PF07731`	Cu-oxidase_2	379	516	1.6e-30	106.4
TkA03G508280	`PF31114`	DUF8814	466	502	0.099	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMW3`	Arabidopsis thaliana	sp\|Q9SMW3\|SKS14_ARATH Protein SKU5 SIMILAR 14	50.200%	Swiss-Prot	High
`Q9SU40`	Arabidopsis thaliana	sp\|Q9SU40\|SKU5_ARATH Monocopper oxidase-like protein SKU5	49.400%	Swiss-Prot	Medium
`Q8VXX5`	Arabidopsis thaliana	sp\|Q8VXX5\|SKS1_ARATH Monocopper oxidase-like protein SKS1	48.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card