TkA03G500250 | RubberDandelionOmics

Gene overview

TkA03G500250

Reference: TK1151 Chr: Chr03 Coordinates: 125616340-125619822 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2344 bp · TkA03G500250|TK1151|cDNA

TTTTCCATATTATTTCTAATGGTTTCTTTTTTCAAACAACAATAGTATTTTGGGTTATCCATAAAATCTTTTTAAATTTGGATAGGGATATTATCCCTGTGAAATCTTCAGGGAAATCATCGTCCCCTTTTAGCGGCAAGAATTTGGATCGAGTTGGCTGACATTTTAACCAATCTTTTCCCATTGAATCATTGATTTTATCAACAGAGTATTTAAATATTCAGCGGCATGCAAATTCCAACTGGAATACTTATTAATAC...

CDS

Download CDS FASTA

1269 bp · TkA03G500250|TK1151|CDS

ATGGCAGTCATGAATGATGCTGGTGCGAATGAACTTCCAGTGAAACTTGAGGGGAAGTTTCTTGCGATTGTGGTATGCTGGATTCTTGGATTCGGATCTTTAGTCGCATGGAACAGTATGTTAACCATAGGAGACTACTACTATGCGGTATTTCCAGATTACCATCCATCAAGGGTACTTACACTAGTCTACCAACCATTCGCAATCGGAACAATCGCGATACTTGCATACCACGAGTCAAAGATCGATACCAGGAAACG...

Protein

Download Protein FASTA

422 aa · TkA03G500250|TK1151|PROTEIN

MAVMNDAGANELPVKLEGKFLAIVVCWILGFGSLVAWNSMLTIGDYYYAVFPDYHPSRVLTLVYQPFAIGTIAILAYHESKIDTRKRNIAGYTLFFVCTLALIVIDLASSGKGGIGNYIAICIFVAGFGIADAHVQGGMVGDLAFMKPEFMQSFLAGLGASGIVTSGLRLVTKAAFDKSSNGLRKGTMLFLGISTFSEFICIFLYAYVFGKLPIVKYYRTKASKEGSKTVTSDLAAAGIQTEPNGPADIDAKVPARLSTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G500250`
TK1151 ID	TkA03G500250
OH-1004 ID	LXL04_010120
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.400
Protein coverage (%)	TK1151 99.763 / OH-1004 27.813 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G500250

Location Chr03:125616340-125619822 (+)

Description Similar to ENT3: Equilibrative nucleotide transporter 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05120`	Nucleoside transporter that functions as a pyrimidine nucleoside carrier in all organs.	Equilibrative nucleoside transporters of Arabidopsis thaliana. cDNA cloning, expression pattern, and analysis of transport activities.2003 · DOI: 10.1074/jbc.m304768200 Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389 The fluorouridine insensitive 1 (fur1) mutant is defective in equilibrative nucleoside transporter 3 (ENT3), and thus represents an important pyrimidine nucleoside uptake system in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2006.02998.x Nucleoside transport across the plasma membrane mediated by equilibrative nucleoside transporter 3 influences metabolism of Arabidopsis seedlings.2012 · DOI: 10.1111/j.1438-8677.2012.00562.x
`At4g05140`	May be involved in nucleoside transport.	No verified direct reference in this release
`At4g05110`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389
`At4g05130`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389
`At1g61630`	Nucleoside transporter that can mediate uptake of adenosine, uridine, guanosine or cytidine when expressed in a heterologous system (yeast).	Characterization of three novel members of the Arabidopsis thaliana equilibrative nucleoside transporter (ENT) family.2004 · DOI: 10.1042/bj20040389

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010120 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015858 nucleoside transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005337 nucleoside transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G05110

ath:AT4G05120

ath:AT4G05140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.630

Rank 1 · TkA03G500250 · TK1151

Lysosome / Vacuole0.179

Rank 2 · TkA03G500250 · TK1151

Cytoplasm0.096

Rank 3 · TkA03G500250 · TK1151

Endoplasmic reticulum0.093

Rank 4 · TkA03G500250 · TK1151

Golgi apparatus0.061

Rank 5 · TkA03G500250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10693DUF249926-80 aa

PF27171YxeC66-124 aa

PF01733Nucleoside_tran128-415 aa

PF27171YxeC299-368 aa

PF10693DUF2499314-378 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G500250	`PF10693`	DUF2499	26	80	0.33	12.0
TkA03G500250	`PF27171`	YxeC	66	124	3.2	8.4
TkA03G500250	`PF01733`	Nucleoside_tran	128	415	2.4e-31	110.0
TkA03G500250	`PF27171`	YxeC	299	368	3.2	8.4
TkA03G500250	`PF10693`	DUF2499	314	378	0.33	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0Y3`	Arabidopsis thaliana	sp\|Q9M0Y3\|ENT3_ARATH Equilibrative nucleotide transporter 3	69.000%	Swiss-Prot	High
`Q9M0Y1`	Arabidopsis thaliana	sp\|Q9M0Y1\|ENT5_ARATH Equilibrative nucleotide transporter 5	64.600%	Swiss-Prot	High
`Q944N8`	Arabidopsis thaliana	sp\|Q944N8\|ENT6_ARATH Equilibrative nucleotide transporter 6	64.900%	Swiss-Prot	High
`Q9M0Y2`	Arabidopsis thaliana	sp\|Q9M0Y2\|ENT4_ARATH Equilibrative nucleotide transporter 4	63.700%	Swiss-Prot	High
`Q944P0`	Arabidopsis thaliana	sp\|Q944P0\|ENT7_ARATH Equilibrative nucleotide transporter 7	60.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card