TkA03G496150 | RubberDandelionOmics

Gene overview

TkA03G496150

Reference: TK1151 Chr: Chr03 Coordinates: 124546892-124548316 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1355 bp · TkA03G496150|TK1151|cDNA

ATATTTTTGTGCCTCTCGATCAAAATTGTCAAGAAAAAGAGACTCGTGGCTTTTTGCTGACGTGACAACTTCTCATTGGATGGAGTGATGCACACTAAAGATTTAGGCAAGCAATGGCGATATTTCCGAAATCAGCTCCGACCCTCTTCCTGTTACTAACAACCACACTTATCTCACTATCCACAACCCTATTCTTCGCCGGCACCACCAACGCCAATGCCGATGCAGATCTAGTTTCCGAACTCCAATCCATCCAATCC...

CDS

Download CDS FASTA

1056 bp · TkA03G496150|TK1151|CDS

ATGGCGATATTTCCGAAATCAGCTCCGACCCTCTTCCTGTTACTAACAACCACACTTATCTCACTATCCACAACCCTATTCTTCGCCGGCACCACCAACGCCAATGCCGATGCAGATCTAGTTTCCGAACTCCAATCCATCCAATCCCGCTCCTCCTCCGGCGTTGTCCACCTCAATGACAACCTTCTGCGCCGCATCATCACCACGAAACCACGATCGTTCTCCTTGATCATCTTCTTCGACGCCATCCAGCTCCATGA...

Protein

Download Protein FASTA

351 aa · TkA03G496150|TK1151|PROTEIN

MAIFPKSAPTLFLLLTTTLISLSTTLFFAGTTNANADADLVSELQSIQSRSSSGVVHLNDNLLRRIITTKPRSFSLIIFFDAIQLHDKSELHLKSLKSEFFLLSKSFGINNENSPSSLSKLFFCDIEFGESQSSFAQFGVNALPHIRLLPPDASTLKSDSISMDAGDFSRLAESMAEFIESRTKLKMGQIHRPPILSKTQMGFLIAAFLISLPFLFKRLLAGETLFHDKRLWLSGSVFVYFFSVSGTMHNIIRKMPMFIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G496150`
TK1151 ID	TkA03G496150
OH-1004 ID	LXL04_010083
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G496150

Location Chr03:124546892-124548316 (-)

Description Similar to OST3B: Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61790`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release
`At1g11560`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0565100`	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010083 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0015693 magnesium ion transport Biological Process

GO:1903830 magnesium ion transmembrane transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0008250 oligosaccharyltransferase complex Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G11560

ath:AT1G61790

bta:615007

dosa:Os03g0565100

mmu:67075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.713

Rank 1 · TkA03G496150 · TK1151

Golgi apparatus0.223

Rank 2 · TkA03G496150 · TK1151

Nucleus0.089

Rank 3 · TkA03G496150 · TK1151

Cytoplasm0.046

Rank 4 · TkA03G496150 · TK1151

Cell membrane0.042

Rank 5 · TkA03G496150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19545DUF606910-32 aa

PF31181Pept_C14_Metacaspase27-82 aa

PF04756OST3_OST643-341 aa

PF31181Pept_C14_Metacaspase245-279 aa

PF19545DUF6069276-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G496150	`PF19545`	DUF6069	10	32	0.26	12.1
TkA03G496150	`PF31181`	Pept_C14_Metacaspase	27	82	0.11	13.9
TkA03G496150	`PF04756`	OST3_OST6	43	341	6.8e-74	249.6
TkA03G496150	`PF31181`	Pept_C14_Metacaspase	245	279	0.11	13.9
TkA03G496150	`PF19545`	DUF6069	276	327	0.26	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYB5`	Arabidopsis thaliana	sp\|Q9SYB5\|OST3B_ARATH Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3B	63.700%	Swiss-Prot	High
`F4I8X8`	Arabidopsis thaliana	sp\|F4I8X8\|OST3A_ARATH Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3A	56.400%	Swiss-Prot	High
`Q94I55`	Oryza sativa subsp. japonica	sp\|Q94I55\|OST3_ORYSJ Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3	59.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card