TkA03G494880 | RubberDandelionOmics

Gene overview

TkA03G494880

Reference: TK1151 Chr: Chr03 Coordinates: 124188399-124192664 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2743 bp · TkA03G494880|TK1151|cDNA

CTTTGCATTGCATTTTGCTAATGAAGTAATAGATCATACAGAAACATCAAATGGAAGGTTTTACAGTGAAAACTAGATCCTCGGCGATTCTTCCCGTTTTCAGGGTTCAGACTCTTACGTTCTTACTCGTTACCCATCGCTCCATTTTCTCTCTGTAAAATCTCTCTGAGTCTGGTGAAGCCACGGTTCATAATTTAACCGATCATCGCGTAATAAACAGTACTGAAACGAAATTTTTTGAAATGAGTGTGGTTGGGTTT...

CDS

Download CDS FASTA

2292 bp · TkA03G494880|TK1151|CDS

ATGAGTGTGGTTGGGTTTGATATCGGGAACGAAACTTGTGTTATTGCTGCTGCAAAGAACCGTGGGATTGATGTATTACTAAACGATGAATCAAACCGTGAGACACCTGCTGTGGTGTGTTTTGGCGAGAAGCAAAGGTTCTTAGGATCTGCTGGTGCTGCATCCGCTACCATGAACCCTAGATCTACCATTTCTCAAGTTAAAAGGTTGATTGGACGTGAATATAACCATCCACTAGTACAAAACGATCTTAAGTTACT...

Protein

Download Protein FASTA

763 aa · TkA03G494880|TK1151|PROTEIN

MSVVGFDIGNETCVIAAAKNRGIDVLLNDESNRETPAVVCFGEKQRFLGSAGAASATMNPRSTISQVKRLIGREYNHPLVQNDLKLLPFETSEASDGGVLIHLQYLNERHTYKPVQILGMLFAHLKQMAEKNLESPVSNCVIGIPSYFTDSQRRAYLDAAHIAGLKPLRLMHDCTAIALGYGIYKTDFSNSGPTNVVFVDIGHCDTQVTVAAFEQGHMKILSHAFDDHLGGRDFDEILFKYFAEKFKQQYNIDVYSNTRA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G494880`
TK1151 ID	TkA03G494880
OH-1004 ID	LXL04_010063
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G494880

Location Chr03:124188399-124192664 (-)

Description Similar to HSP70-16: Heat shock 70 kDa protein 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g11660`	Heat shock 70 kDa protein 16.	No verified direct reference in this release
`At1g79930`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release
`At1g79920`	In cooperation with other chaperones, Hsp70s are key components that facilitate folding of de novo synthesized proteins, assist translocation of precursor proteins into organelles, and are responsible for degradation of damaged protein under stress conditions.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010063 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006986 response to unfolded protein Biological Process

GO:0009408 response to heat Biological Process

GO:1904276 regulation of wax biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0000774 adenyl-nucleotide exchange factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G11660

ath:AT1G79920

ath:AT1G79930

hsa:22824

mmu:18415

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.610

Rank 1 · TkA03G494880 · TK1151

Nucleus0.440

Rank 2 · TkA03G494880 · TK1151

Cell membrane0.071

Rank 3 · TkA03G494880 · TK1151

Mitochondrion0.061

Rank 4 · TkA03G494880 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA03G494880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00012HSP703-652 aa

PF06723MreB_Mbl123-375 aa

PF14164YqzH300-324 aa

PF14164YqzH559-590 aa

PF24079UBR4561-600 aa

PF27508HYOU1_C604-624 aa

PF14164YqzH639-656 aa

PF24079UBR4645-733 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G494880	`PF00012`	HSP70	3	652	2.3e-152	509.0
TkA03G494880	`PF06723`	MreB_Mbl	123	375	2.5e-10	40.4
TkA03G494880	`PF14164`	YqzH	300	324	4.0	8.5
TkA03G494880	`PF14164`	YqzH	559	590	4.0	8.5
TkA03G494880	`PF24079`	UBR4	561	600	6.8	7.8
TkA03G494880	`PF27508`	HYOU1_C	604	624	4.7e-09	37.1
TkA03G494880	`PF14164`	YqzH	639	656	4.0	8.5
TkA03G494880	`PF24079`	UBR4	645	733	6.8	7.8
TkA03G494880	`PF00012`	HSP70	655	735	2.3e-152	509.0
TkA03G494880	`PF14164`	YqzH	665	697	4.0	8.5
TkA03G494880	`PF27508`	HYOU1_C	681	736	4.7e-09	37.1
TkA03G494880	`PF14164`	YqzH	726	739	4.0	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAB1`	Arabidopsis thaliana	sp\|Q9SAB1\|HSP7Q_ARATH Heat shock 70 kDa protein 16	61.900%	Swiss-Prot	High
`Q9S7C0`	Arabidopsis thaliana	sp\|Q9S7C0\|HSP7O_ARATH Heat shock 70 kDa protein 14	49.600%	Swiss-Prot	Medium
`F4HQD4`	Arabidopsis thaliana	sp\|F4HQD4\|HSP7P_ARATH Heat shock 70 kDa protein 15	49.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card