TkA03G493980 | RubberDandelionOmics

Gene overview

TkA03G493980

Reference: TK1151 Chr: Chr03 Coordinates: 123893763-123897564 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2058 bp · TkA03G493980|TK1151|cDNA

TTGCATCTCATTTATGGCTTCCCCTTTCTTTCTCTCCCTCACTCTCTCTCTTCACTCTTTACACCTCCTCTGTTCTATATTCTCCATTTCTCACCACCCTTTCTCAATTGAAACTCAAAAAGCTTTTGCATAAATTCTAGTATCCTCTCTCTTTCATTTACCCCTTTTCACTATAAAATTTCCGCGTTTCTTCGAGTACGAGAGAAACCCATCAAGCATGAGAGAAACGATAGCGCAAAAGCTCAATCTCAAGCTCATTT...

CDS

Download CDS FASTA

1377 bp · TkA03G493980|TK1151|CDS

ATGAGAGAAACGATAGCGCAAAAGCTCAATCTCAAGCTCATTTTCCTATTTCTGCTGCTTTTCTGTTTCAACAGGTCCAATTGTAGCTCATTGAATAATGTGAAAATGACGATGCAATTTGATGAAAAAGTGGATAACTTATTGCCCCTAATTTCTCCGACTGGAAACCCTGAACCCCTTTATCCTCTTCTTGCACCATCTCCATTATCACCCTTCACTATCACAAACAACACAGCTCCGAAGTTATCAGGATTGTGTAC...

Protein

Download Protein FASTA

458 aa · TkA03G493980|TK1151|PROTEIN

MRETIAQKLNLKLIFLFLLLFCFNRSNCSSLNNVKMTMQFDEKVDNLLPLISPTGNPEPLYPLLAPSPLSPFTITNNTAPKLSGLCTLDFEAMNAMTSMTAIDCFTVFAPYLANVVCCPQFEATLVILIGQSSKKTKTLSLNSTLAKHCLSDFDQILMGQGANNSLQKICSVAPSNLTEGSCPVTDVAQFEKMVNSSKILAKCGKIDLVNECCQEVCQNAISEAAKDLASASYELDSMGLKRPSDISNRVVNDCKGIVLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G493980`
TK1151 ID	TkA03G493980
OH-1004 ID	LXL04_010061
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G493980

Location Chr03:123893763-123897564 (+)

Description Similar to At1g61900: Uncharacterized GPI-anchored protein At1g61900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61900`	Uncharacterized GPI-anchored protein At1g61900.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010061 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G61900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.669

Rank 1 · TkA03G493980 · TK1151

Endoplasmic reticulum0.124

Rank 2 · TkA03G493980 · TK1151

Cytoplasm0.101

Rank 3 · TkA03G493980 · TK1151

Lysosome / Vacuole0.082

Rank 4 · TkA03G493980 · TK1151

Extracellular0.080

Rank 5 · TkA03G493980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19160SPARK83-231 aa

PF26584At1g6190096-113 aa

PF26578LLG1112-123 aa

PF26578LLG1189-220 aa

PF26584At1g61900194-216 aa

PF26584At1g61900285-358 aa

PF19160SPARK285-359 aa

PF26578LLG1293-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G493980	`PF19160`	SPARK	83	231	2.7e-22	80.6
TkA03G493980	`PF26584`	At1g61900	96	113	2.2e-33	114.9
TkA03G493980	`PF26578`	LLG1	112	123	0.73	10.5
TkA03G493980	`PF26578`	LLG1	189	220	0.73	10.5
TkA03G493980	`PF26584`	At1g61900	194	216	2.2e-33	114.9
TkA03G493980	`PF26584`	At1g61900	285	358	2.2e-33	114.9
TkA03G493980	`PF19160`	SPARK	285	359	2.7e-22	80.6
TkA03G493980	`PF26578`	LLG1	293	345	0.73	10.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUI4`	Arabidopsis thaliana	sp\|Q8GUI4\|UGPI6_ARATH Uncharacterized GPI-anchored protein At1g61900	54.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card