Gene Card
Gene overview
cDNA / CDS / Protein Sequences
531 bp · TkA03G488350|TK1151|cDNA
ATGGAGAAAAATTTGGACAACATTAGTTTCTCTGTTACTGAAAGTGGGTCTAACTCTAACAAACAAACATCAAATAAAGGATTAAAGAAGAAAAAAGGGAAATCCAACACAAATAGCATATTATACGCAACACGATGTACAGGGACCAATACCGACACAGTAAAAGGGTATAAAGTGCTTGTAATGGGTACGGCTATGCTTGGTCTTTGGGAAGAGGCAGCACCTGACTTCGGTATATCATCAAATTTAGATTATGATGA...
336 bp · TkA03G488350|TK1151|CDS
ATGGAGAAAAATTTGGACAACATTAGTTTCTCTGTTACTGAAAGTGGGTCTAACTCTAACAAACAAACATCAAATAAAGGATTAAAGAAGAAAAAAGGGAAATCCAACACAAATAGCATATTATACGCAACACGATGTACAGGGACCAATACCGACACAGTAAAAGGGTATAAAGTGCTTGTAATGGGTACGGCTATGCTTGGTCTTTGGGAAGAGGCAGCACCTGACTTCGGTATATCATCAAATTTAGATTATGATGA...
Protein
Download Protein FASTA111 aa · TkA03G488350|TK1151|PROTEIN
MEKNLDNISFSVTESGSNSNKQTSNKGLKKKKGKSNTNSILYATRCTGTNTDTVKGYKVLVMGTAMLGLWEEAAPDFGISSNLDYDDENGSLLKNANLKIRTKNEKVLILD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G488350 |
|---|---|
| TK1151 ID | TkA03G488350 |
| OH-1004 ID | LXL04_035515 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 71.100 |
| Protein coverage (%) | TK1151 40.541 / OH-1004 12.295Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G488350 |
|---|---|
| Location | Chr03:122216042-122216827 (+) |
| Description | Similar to TDX: TPR repeat-containing thioredoxin TDX |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0006950 response to stress Biological Process GO:0010286 heat acclimation Biological Process GO:0051259 protein complex oligomerization Biological Process GO:0000118 histone deacetylase complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0016667 oxidoreductase activity, acting on a sulfur group of donors Molecular Function GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function GO:0030544 Hsp70 protein binding Molecular Function GO:0042802 identical protein binding Molecular Function |
| KEGG gene cross-reference | ath:AT3G17880 ath:AT4G22670 dosa:Os09g0401200 gga:418003 osa:4346999 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.