TkA03G487750 | RubberDandelionOmics

Gene overview

TkA03G487750

Reference: TK1151 Chr: Chr03 Coordinates: 122059519-122059881 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · TkA03G487750|TK1151|cDNA

ATGGCTTATACTCATTCCAGATCTTCCTTTCTGATCCTCATTCCTCTCTTTTTGATCTTTGTTGGTATTTGTTTTGCTGAAAATGGCCAAAAGACAGTAGGCAACTGGCTAGAGATCGCGAGCCCAGATGATCCTGCTGTGATAGAGGTAGGGCAGTTTGCAGTGGATCAACACAACAAAGATACTAATAGTACTTTGAAGTTTGAGAGTGTAGTCAAAGGTGACACTCAGATTGTAGGTGGCATGAATTGGCGGCTAAC...

CDS

Download CDS FASTA

363 bp · TkA03G487750|TK1151|CDS

ATGGCTTATACTCATTCCAGATCTTCCTTTCTGATCCTCATTCCTCTCTTTTTGATCTTTGTTGGTATTTGTTTTGCTGAAAATGGCCAAAAGACAGTAGGCAACTGGCTAGAGATCGCGAGCCCAGATGATCCTGCTGTGATAGAGGTAGGGCAGTTTGCAGTGGATCAACACAACAAAGATACTAATAGTACTTTGAAGTTTGAGAGTGTAGTCAAAGGTGACACTCAGATTGTAGGTGGCATGAATTGGCGGCTAAC...

Protein

Download Protein FASTA

120 aa · TkA03G487750|TK1151|PROTEIN

MAYTHSRSSFLILIPLFLIFVGICFAENGQKTVGNWLEIASPDDPAVIEVGQFAVDQHNKDTNSTLKFESVVKGDTQIVGGMNWRLTIAVIDDKTLKNCSAYVYEQPWQNVRKLISFKII

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G487750`
TK1151 ID	TkA03G487750
OH-1004 ID	LXL04_034328
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	38.500
Protein coverage (%)	TK1151 85.833 / OH-1004 93.103 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G487750

Location Chr03:122059519-122059881 (-)

Description Similar to CYS5: Cysteine proteinase inhibitor 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47550`	Specific inhibitor of cysteine proteinases.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034328 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004869 cysteine-type endopeptidase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT5G47550

dosa:Os03g0429000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.446

Rank 1 · TkA03G487750 · TK1151

Endoplasmic reticulum0.203

Rank 2 · TkA03G487750 · TK1151

Lysosome / Vacuole0.187

Rank 3 · TkA03G487750 · TK1151

Cytoplasm0.177

Rank 4 · TkA03G487750 · TK1151

Cell membrane0.062

Rank 5 · TkA03G487750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22385Cas9_C_236-97 aa

PF00031Cystatin40-105 aa

PF16845SQAPI43-118 aa

PF07430PP146-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G487750	`PF22385`	Cas9_C_2	36	97	0.17	12.4
TkA03G487750	`PF00031`	Cystatin	40	105	5.8e-09	36.8
TkA03G487750	`PF16845`	SQAPI	43	118	1.3e-23	83.8
TkA03G487750	`PF07430`	PP1	46	117	0.00087	20.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q41916`	Arabidopsis thaliana	sp\|Q41916\|CYT5_ARATH Cysteine proteinase inhibitor 5	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card