RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G487330
Reference: TK1151 Chr: Chr03 Coordinates: 121969309-121971855 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2083 bp · TkA03G487330|TK1151|cDNA

CTTCCCAAAACCCTAAAAGCAAAAAAGTACCAAATCCACTCATTCCCCCCATGAAAATATATATTCATCTCACTCACCCATCCTACTCTTTTTCTACCCAAAAAAATCAACCAATCTTTGTGCTTATGCCCATTTCAAGCTAAATACTACAATCTCCCATGGTTTCTCTTCAAGAATCCCCCAATTCCACTCCGGGTCGGTTTCAGATTACCCGACCCTATTACACTCCACCTCCATCTTCCGCTGCTTCTTCCCCATCC...

CDS

Download CDS FASTA

1446 bp · TkA03G487330|TK1151|CDS

ATGGTTTCTCTTCAAGAATCCCCCAATTCCACTCCGGGTCGGTTTCAGATTACCCGACCCTATTACACTCCACCTCCATCTTCCGCTGCTTCTTCCCCATCCAGGTTCCAGAAGCATCTAGGTCGATCCATGCGAACTGTGCGCTCCAATTTCTACCAGTCCGAATACACCGACAGTTGCTCTTTCGTTTCCACTCAACAGGCTGCACCGTCCGTTGTATCGGAAAACCTTACGGACTCCGTCATCGATGTTCATTTACA...

Protein

Download Protein FASTA

481 aa · TkA03G487330|TK1151|PROTEIN

MVSLQESPNSTPGRFQITRPYYTPPPSSAASSPSRFQKHLGRSMRTVRSNFYQSEYTDSCSFVSTQQAAPSVVSENLTDSVIDVHLHQLATATGNNKFSKSSSETSSEDFPGFSQVFSDFSAYSSDISGELQRLACLPEDLNENDFNQEQGPEPEPCLGFLQREHFSTEIIESISPEDLQPTVKICVDSLGSNSVALKRSAAAKLRMLAKNRSENRALIGESGAVPALIPLLRCADPWTQEHAVTALLNLSLLDENKPLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G487330
TK1151 IDTkA03G487330
OH-1004 IDLXL04_009977
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G487330
LocationChr03:121969309-121971855 (-)
DescriptionSimilar to PUB4: U-box domain-containing protein 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g67340 Functions as an E3 ubiquitin ligase. No verified direct reference in this release
At3g54850 Functions as an E3 ubiquitin ligase with specific E2 ubiquitin-conjugating enzymes.
Structure and biochemical function of a prototypical Arabidopsis U-box domain.2004 · DOI: 10.1074/jbc.m405057200

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2ZLU6 Defense related protein that negatively regulates programmed cell death. No verified direct reference in this release
Os12g0570000 E3 ubiquitin-protein ligase that negatively regulates programmed cell death and disease resistance.
Spotted leaf11, a negative regulator of plant cell death and defense, encodes a U-box/armadillo repeat protein endowed with E3 ubiquitin ligase activity.2004 · DOI: 10.1105/tpc.104.025171
SPIN1, a K homology domain protein negatively regulated and ubiquitinated by the E3 ubiquitin ligase SPL11, is involved in flowering time control in rice.2008 · DOI: 10.1105/tpc.108.058610
Os06g0102700 Possesses E3 ubiquitin-protein ligase in vitro. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009977 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0016567 protein ubiquitination Biological Process
GO:0031648 protein destabilization Biological Process
GO:0034614 cellular response to reactive oxygen species Biological Process
GO:0048364 root development Biological Process
GO:0048658 anther wall tapetum development Biological Process
GO:0051865 protein autoubiquitination Biological Process
GO:0090333 regulation of stomatal closure Biological Process
GO:1904821 chloroplast disassembly Biological Process
GO:2000022 regulation of jasmonic acid mediated signaling pathway Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0004842 ubiquitin-protein transferase activity Molecular Function
KEGG gene cross-reference
ath:AT1G23030
ath:AT1G71020
ath:AT2G23140
ath:AT3G54790
ath:AT5G67340
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.553
Rank 1 · TkA03G487330 · TK1151
Nucleus0.373
Rank 2 · TkA03G487330 · TK1151
Cell membrane0.177
Rank 3 · TkA03G487330 · TK1151
Endoplasmic reticulum0.052
Rank 4 · TkA03G487330 · TK1151
Golgi apparatus0.050
Rank 5 · TkA03G487330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30196WRM1_C171-240 aa
PF03224V-ATPase_H_N178-233 aa
PF24768ARM_ARMC5183-321 aa
PF25598ARM_PUB200-467 aa
PF30701ARMC6204-278 aa
PF00514Arm213-251 aa
PF05536Neurochondrin213-250 aa
PF30699ARM_GAC_2215-348 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G487330PF30196WRM1_C1712400.001718.1
TkA03G487330PF03224V-ATPase_H_N1782330.2111.7
TkA03G487330PF24768ARM_ARMC51833215.3e-1969.4
TkA03G487330PF25598ARM_PUB2004676.7e-2279.0
TkA03G487330PF30701ARMC62042780.01314.8
TkA03G487330PF00514Arm2132512.5e-30104.2
TkA03G487330PF05536Neurochondrin2132500.000619.1
TkA03G487330PF30699ARM_GAC_22153480.0004719.3
TkA03G487330PF13646HEAT_22182500.02815.4
TkA03G487330PF26524ARM_72202510.1112.6
TkA03G487330PF30196WRM1_C2253360.001718.1
TkA03G487330PF13646HEAT_22262880.02815.4
TkA03G487330PF19427Insc_C2342860.1211.5
TkA03G487330PF12031BAF250_C2412660.01415.4
TkA03G487330PF24768ARM_ARMC52464535.3e-1969.4
TkA03G487330PF00514Arm2542922.5e-30104.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q5XEZ8Arabidopsis thalianasp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 262.800%Swiss-ProtMedium
Q8VZ40Arabidopsis thalianasp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 1459.400%Swiss-ProtMedium
A2ZLU6Oryza sativa subsp. indicasp|A2ZLU6|SL11_ORYSI Protein spotted leaf 1163.000%Swiss-ProtLow
Q0IMG9Oryza sativa subsp. japonicasp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL1163.000%Swiss-ProtLow
Q5VRH9Oryza sativa subsp. japonicasp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 1251.500%Swiss-ProtLow

JBrowse

View in Genome Browser