TkA03G486000 | RubberDandelionOmics

Gene overview

TkA03G486000

Reference: TK1151 Chr: Chr03 Coordinates: 121634293-121635731 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA03G486000|TK1151|cDNA

ATGAACCAATTTCAGGGATATAGATCATTCCAACAAAATCATTATGCTTCAAGCAGGAAAGCGAAAAAGGAAAGGAGAAAGGAAAAAAACCTATCGGCGCCAGAGGAGAAAGCTGATGAGGGAACAACGGAGATGGAGGCAAGGACGATGATGCTCCAGAGGGTGATGGAGATGTATACGACCGAGTCAGTGGCATCAAATGGTAATATCAAACAAACTGATTGGACTGGGCCAGATAAAAAGAAGCATTCCAGTTTCAG...

CDS

Download CDS FASTA

405 bp · TkA03G486000|TK1151|CDS

ATGAACCAATTTCAGGGATATAGATCATTCCAACAAAATCATTATGCTTCAAGCAGGAAAGCGAAAAAGGAAAGGAGAAAGGAAAAAAACCTATCGGCGCCAGAGGAGAAAGCTGATGAGGGAACAACGGAGATGGAGGCAAGGACGATGATGCTCCAGAGGGTGATGGAGATGTATACGACCGAGTCAGTGGCATCAAATGGTAATATCAAACAAACTGATTGGACTGGGCCAGATAAAAAGAAGCATTCCAGTTTCAG...

Protein

Download Protein FASTA

134 aa · TkA03G486000|TK1151|PROTEIN

MNQFQGYRSFQQNHYASSRKAKKERRKEKNLSAPEEKADEGTTEMEARTMMLQRVMEMYTTESVASNGNIKQTDWTGPDKKKHSSFSLDEKRNDKKQGHGVVFQVVIEGIWKAYDYRIVVAEMRGINSECYGHL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G486000`
TK1151 ID	TkA03G486000
OH-1004 ID	LXL04_009965
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 35.544 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G486000`
Location	Chr03:121634293-121635731 (-)
Description	Similar to PSD2: Phosphatidylserine decarboxylase proenzyme 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009965` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006646 phosphatidylethanolamine biosynthetic process Biological Process GO:0016540 protein autoprocessing Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005774 vacuolar membrane Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0009705 plant-type vacuole membrane Cellular Component GO:0004609 phosphatidylserine decarboxylase activity Molecular Function GO:0005509 calcium ion binding Molecular Function
KEGG gene cross-reference	ath:AT4G25970 ath:AT5G57190 dosa:Os01g0959800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.487

Rank 1 · TkA03G486000 · TK1151

Cytoplasm0.373

Rank 2 · TkA03G486000 · TK1151

Mitochondrion0.128

Rank 3 · TkA03G486000 · TK1151

Cell membrane0.097

Rank 4 · TkA03G486000 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA03G486000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15012DUF451917-29 aa

PF17705DUF555118-107 aa

PF15012DUF451980-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G486000	`PF15012`	DUF4519	17	29	0.26	12.2
TkA03G486000	`PF17705`	DUF5551	18	107	0.17	12.2
TkA03G486000	`PF15012`	DUF4519	80	107	0.26	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card