TkA03G483420 | RubberDandelionOmics

Gene overview

TkA03G483420

Reference: TK1151 Chr: Chr03 Coordinates: 120917694-120920762 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1542 bp · TkA03G483420|TK1151|cDNA

CTGTGTTCCCATCGATCTCCACTCAATTTTTACCACCTAGGTTAAATTTTGCGTTCCCATGTGGCCATGTGTATATATAAACCCAGCCATGTCCTCCATTGAAGCACACCAAGTTGCTGAGAGAGATATATATATATACACAGAGAGATATATATATAGAAGATAGTTTAGTACCTAGAGTTAGTGAAATAATGGGGTTGCTAAGAGAAGTCCTGAACTCATCGAAACCATACCTAGCGATGGTTTCTCTCCAGTTTGGT...

CDS

Download CDS FASTA

1134 bp · TkA03G483420|TK1151|CDS

ATGGGGTTGCTAAGAGAAGTCCTGAACTCATCGAAACCATACCTAGCGATGGTTTCTCTCCAGTTTGGTTATGCCGGAATGTATATCATAACCATGATCGGCATGAAGCGAGGACTCAGCCACTGGATTCTCGTGGTCTATCGCCATGCCACGGCGACTCTCGTCATTTCTCCTTTTGCCTTTGCTTTTGAGAGGAAAATAAGGCCAAAGATGACACGTTCGGTCTTCGTTAAAGTTCTGCTTCTTGGTTTGCTAGAGCC...

Protein

Download Protein FASTA

377 aa · TkA03G483420|TK1151|PROTEIN

MGLLREVLNSSKPYLAMVSLQFGYAGMYIITMIGMKRGLSHWILVVYRHATATLVISPFAFAFERKIRPKMTRSVFVKVLLLGLLEPVIDQNLYFLGMSITSATYASAIVNVLPALTFVMALVFRLEKVNLKRIHSQAKVIGTVITLVGATVMTLYKGPIVDILWYSHHGATTTPEAAAAASSGQHWLAGTIMILICTCCWAGYFILQSITLKEYPAELSLTSLICLAGTVEGGIIAIIMERDPKAWALGFDSRLLASVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G483420`
TK1151 ID	TkA03G483420
OH-1004 ID	LXL04_009934
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G483420

Location Chr03:120917694-120920762 (-)

Description Similar to At1g21890: WAT1-related protein At1g21890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21890`	WAT1-related protein At1g21890.	No verified direct reference in this release
`At1g44800`	WAT1-related protein At1g44800.	No verified direct reference in this release
`At4g08300`	WAT1-related protein At4g08300.	No verified direct reference in this release
`At2g39510`	WAT1-related protein At2g39510.	No verified direct reference in this release
`At4g08290`	WAT1-related protein At4g08290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009934 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006865 amino acid transport Biological Process

GO:0009620 response to fungus Biological Process

GO:0032973 amino acid export across plasma membrane Biological Process

GO:0043090 amino acid import Biological Process

GO:0048316 seed development Biological Process

GO:0080144 intracellular amino acid homeostasis Biological Process

GO:0098712 L-glutamate import across plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015171 amino acid transmembrane transporter activity Molecular Function

GO:0015186 L-glutamine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G21890

ath:AT1G44800

ath:AT2G39510

ath:AT4G08290

ath:AT4G08300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.516

Rank 1 · TkA03G483420 · TK1151

Lysosome / Vacuole0.182

Rank 2 · TkA03G483420 · TK1151

Endoplasmic reticulum0.162

Rank 3 · TkA03G483420 · TK1151

Cytoplasm0.071

Rank 4 · TkA03G483420 · TK1151

Golgi apparatus0.070

Rank 5 · TkA03G483420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00892EamA14-154 aa

PF10639TMEM23493-153 aa

PF10942DUF2619137-155 aa

PF04226Transgly_assoc142-150 aa

PF00892EamA189-327 aa

PF27963VOPP1_C192-206 aa

PF27963VOPP1_C263-267 aa

PF10942DUF2619268-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G483420	`PF00892`	EamA	14	154	2e-23	83.9
TkA03G483420	`PF10639`	TMEM234	93	153	0.71	10.7
TkA03G483420	`PF10942`	DUF2619	137	155	5.1	8.0
TkA03G483420	`PF04226`	Transgly_assoc	142	150	3.6	8.6
TkA03G483420	`PF00892`	EamA	189	327	2e-23	83.9
TkA03G483420	`PF27963`	VOPP1_C	192	206	0.24	11.6
TkA03G483420	`PF27963`	VOPP1_C	263	267	0.24	11.6
TkA03G483420	`PF10942`	DUF2619	268	330	5.1	8.0
TkA03G483420	`PF10639`	TMEM234	289	324	0.71	10.7
TkA03G483420	`PF04226`	Transgly_assoc	291	304	3.6	8.6
TkA03G483420	`PF04226`	Transgly_assoc	309	321	3.6	8.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HZQ7`	Arabidopsis thaliana	sp\|F4HZQ7\|WTR5_ARATH WAT1-related protein At1g21890	60.500%	Swiss-Prot	High
`Q9LPF1`	Arabidopsis thaliana	sp\|Q9LPF1\|WTR8_ARATH WAT1-related protein At1g44800	58.400%	Swiss-Prot	High
`Q501F8`	Arabidopsis thaliana	sp\|Q501F8\|WTR32_ARATH WAT1-related protein At4g08300	57.800%	Swiss-Prot	High
`O80638`	Arabidopsis thaliana	sp\|O80638\|WTR14_ARATH WAT1-related protein At2g39510	52.200%	Swiss-Prot	High
`Q9SUF1`	Arabidopsis thaliana	sp\|Q9SUF1\|WTR31_ARATH WAT1-related protein At4g08290	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card