TkA03G482050 | RubberDandelionOmics

Gene overview

TkA03G482050

Reference: TK1151 Chr: Chr03 Coordinates: 120574146-120576229 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1034 bp · TkA03G482050|TK1151|cDNA

TTGAATTATCATTTGGACCACTCGCAAGCGGCAACCTTTTTCTTCTCCCAAGTTACGAACTTCAGAATAATGGGGTCACTGGGTGGTGGCTTCGGCAACAATGGAATTTGGGGAATGAGGCCTTTTGATTCTCAAGATGGAGACAAAGGAAGACGAAAACCACCAAAATCATCAGGATCATCTCAGCCTTCCGGCGAACCAGGTAGTCGCTTCCCCGTGAAGCAAGCAGCGACATCCGCTGCTCTTGCCCTAACCGGCGA...

CDS

Download CDS FASTA

681 bp · TkA03G482050|TK1151|CDS

ATGGGGTCACTGGGTGGTGGCTTCGGCAACAATGGAATTTGGGGAATGAGGCCTTTTGATTCTCAAGATGGAGACAAAGGAAGACGAAAACCACCAAAATCATCAGGATCATCTCAGCCTTCCGGCGAACCAGGTAGTCGCTTCCCCGTGAAGCAAGCAGCGACATCCGCTGCTCTTGCCCTAACCGGCGACACTATTGCTCAGCTTCGCGAGAGATGGGTAAAGAACAAAGCCCTCCAAAATCAACATCCTGCCGATTC...

Protein

Download Protein FASTA

226 aa · TkA03G482050|TK1151|PROTEIN

MGSLGGGFGNNGIWGMRPFDSQDGDKGRRKPPKSSGSSQPSGEPGSRFPVKQAATSAALALTGDTIAQLRERWVKNKALQNQHPADSHEDLTWAIMDHNWLRALRMASYGFLLYGPGSYVWYQYLDHCMPTQTAKNVAIKVVLNQIVLGPCVIAVVFAWNNLWQGKLAELPNKYQKDALRTLLFGFRFWIPVSVINFWAIPLQARVAFMSMNSIFWNFYLSSTMSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G482050`
TK1151 ID	TkA03G482050
OH-1004 ID	LXL04_031750
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	28.900
Protein coverage (%)	TK1151 50.000 / OH-1004 62.570 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G482050`
Location	Chr03:120574146-120576229 (+)
Description	Similar to DDB_G0290631: PXMP2/4 family protein 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031750` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006067 ethanol metabolic process Biological Process GO:1901858 regulation of mitochondrial DNA metabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0015267 channel activity Molecular Function
KEGG gene cross-reference	aor:AO090010000224 ddi:DDB_G0290631 fgr:FGSG_00730 ncr:NCU02117 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.694

Rank 1 · TkA03G482050 · TK1151

Plastid0.201

Rank 2 · TkA03G482050 · TK1151

Cytoplasm0.046

Rank 3 · TkA03G482050 · TK1151

Peroxisome0.035

Rank 4 · TkA03G482050 · TK1151

Nucleus0.030

Rank 5 · TkA03G482050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08179SspP23-44 aa

PF04117Mpv17_PMP22135-158 aa

PF28576Transporter_C139-200 aa

PF04117Mpv17_PMP22162-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G482050	`PF08179`	SspP	23	44	0.32	12.2
TkA03G482050	`PF04117`	Mpv17_PMP22	135	158	2.4e-15	57.0
TkA03G482050	`PF28576`	Transporter_C	139	200	0.084	13.7
TkA03G482050	`PF04117`	Mpv17_PMP22	162	221	2.4e-15	57.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card